KEGG   Acinetobacter junii: BVL33_03660Help
Entry
BVL33_03660       CDS       T04674                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
ajn  Acinetobacter junii
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BVL33_03660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: APU47680
UniProt: A0A4Q7ATM2
LinkDB All DBs
Position
complement(738925..740175)
Genome map
AA seq 416 aa AA seqDB search
MILDRYLKNRAFLEKTWFQFIVFVLRRFEADRCREQAGSLTYTTLFAVVPMLTVFLVIIS
SIKALEPARQQLQQLIYSNFLPKSTIAFDKALNAFTEKSSNLTVIGVLFLFVTTVLMLTS
IETVFNRIWRVKETRTGLVGFMRYWTIISLGPIVLGSAFVLSSTVASMNVLSNNFAGYQL
DGALILWLISFILTIVGFFILYWTIPNRTVPIFSAVIAACFSATVFEILKRLFGWIMSNF
TSYEIVYGAFAAVPIFLLWIYLSWNIILLGVEVSYALTAFHSGKEKKRHPILMLLDILEL
FYRKQQIGESVSEQELLNIIGRGELGRLPSYILQLEKQNLIKRTDTDEYVLVRNLAQVDF
WSFFTALPYPLPLRHDVANIHEDDEWIERLGPSLVESNDYLAAKLSIPLSTIFEQK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagaccgttatctaaaaaaccgagcgtttttagagaaaacatggtttcaattt
attgtatttgtgttacgacgttttgaggctgaccgatgccgagagcaagctggatcactt
acctatacgaccctttttgctgttgttccgatgttgacagtttttttagtcatcatctcc
tccatcaaagcattagagccagcaagacaacagttacaacaactgatctatagtaatttt
ttacctaaaagcacaatcgcctttgacaaagccctgaatgcatttactgaaaaatccagt
aatttgactgtgattggtgtgttgtttttatttgtgaccacagtcttaatgctgacttcg
attgaaacagtatttaatcgcatttggcgtgtcaaagaaacacgaactggtcttgtcggc
tttatgcgctattggacaatcatttcattaggtccaattgtgctgggaagtgcgtttgta
ctttcttcaactgtcgcatcaatgaatgttttaagtaacaactttgcgggttatcagctt
gatggtgcgttaattttatggctcatttcctttattttgaccattgtcggattcttcatt
ttatattggacgatccccaatcggacggtaccaattttttcagctgtgattgcggcatgt
ttcagtgcgaccgtttttgaaattttaaaacgtttatttggctggataatgagtaatttc
actagctatgaaatcgtttatggtgcttttgcagcagttcctatttttctactttggatc
tatctgtcttggaatatcattttattgggtgtggaagtgagttatgcactcaccgccttt
cattctggtaaagaaaaaaagcgccatccaattttgatgttattggatattttagaattg
ttttaccgtaagcaacaaatcggtgaaagtgttagcgagcaagagctactcaatattatt
ggtcgtggtgagcttggtcgtttaccctcttacatccttcagcttgaaaagcaaaatctg
attaaacgcaccgatacggacgaatatgttctggtacgaaatctagcacaagtcgatttt
tggagcttttttacagctctaccgtatccattgccattacgccatgatgttgccaatatt
catgaagacgatgaatggattgaacgccttgggccatcgctagtggaaagtaatgactac
ttagcagcaaaactttccatcccactttcaactatttttgaacagaaataa

DBGET integrated database retrieval system