KEGG   Acinetobacter junii: BVL33_05565Help
Entry
BVL33_05565       CDS       T04674                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
ajn  Acinetobacter junii
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ajn03036]
    BVL33_05565
Chromosome and associated proteins [BR:ajn03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    BVL33_05565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_15 AAA_21 AAA_29 Nup54 BLOC1_2
Motif
Other DBs
NCBI-ProteinID: APU48009
UniProt: A0A4T1CQJ0
LinkDB All DBs
Position
1138838..1142287
Genome map
AA seq 1149 aa AA seqDB search
MRLSSLKLSGFKSFADSTTLHFKANRTAVVGPNGCGKSNVIDAIRWVMGESNARQLRGGS
MQDVIFTGTSKRKPVGVASVELRFDNTYGKLGGAYNAYNELAVRRQVTREGKSEYFLNGT
RCRRRDITDIFLGTGLGPRSYAVIEQGMINRLVDAKPEEMRVFIEEAAGVSRYQARRRET
LQHLEHTEQNLARLEDIAAELKSQLRTLKRQSEAAIQYKTLETQIRTLKIEILSFQANQS
QKLQQEYTVEMNELGERFKLVRSESHTIEHDLEATSALFQRLIQQSSPLQHEWQQAEKKL
AELKMTLEQKQSLFQQNSSSLIQLEQQKLQTKERLQLSELQVETLTAQYDEQSEALVELE
QQTQSTEHHFSDLQAQQKQAQQQFEQIKTQVDQQQQKKLQMAAQIEQLAKNVQRIEQQKQ
TLQNQSNQIRAQVQDDEQAQLEQLQQQLQQEIIILETEIEQFQQNTKILQDQQQQDKTNL
QSLKTEIQVLLAEQKNLNQLLAKKSPKQNQNAVRLMQSLRLTTQGKAHTVIIEKFLAKWL
QAQLIESGQTFQEDVARQLKSSTQQKIQIQQLRRLNDFIEAPQSSLWANVAVADDLTTAL
SHQSDLIHAQSILTLDGYHVGADWVIALHYDEDSQSAQGMLSHQVRLEEIEQQLAEMQPQ
LLELENQFSIQQQTLQQQQQHLQQQQQSQKQKQKELQQLDVQIAKLQSTAQAYVLQQQQL
ADQLKQLDLQLEEDAMQRDDLEIDLHALAIKLEAVLPNYKTLQFQVESLNEQLDEQQQQL
TQQQQHREVLRRQTSQANQQIELLEKDISFLKTQYRQIIEQIEQAKKFVDPIQLELPNLE
SEFHEQFQQTEKLQKTWNEWQLELNQVQEKQQQLTEQRHQAQQKDEQVREQLEQKRLAWQ
AAKSDREHYLEQLKELNSEPVSDLSIEIKEHQQKLEKAQQQFEKIGAVNLAASQEYEEVS
QRFDELSHQMQDLQNTVDQLKDAMKSIDQETRKLFMTTFDQVNQELQVLFPKVFNGGEAT
LSLEDDWQSGVKLMARPPGKRNSSLALLSGGEKALTALALVFAIFRLNPAPFCVLDEVDA
PLDDANVQRYCNLVKELSEQVQFIYITHNKLAMTMATDLLGVTMPEPGTSKLVTVDLEQA
KEYGLVAES
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttaagcagtttaaaactttcaggctttaaatcttttgccgatagtaccacttta
cattttaaggcgaaccgcactgcggtagttgggccgaacggttgcggaaaatcgaatgtg
attgatgcgatccgttgggttatgggcgaatcgaatgcacgtcagttgcgtggcggtagt
atgcaggatgttatttttacagggacatctaagcgtaaacctgtcggtgttgccagtgta
gagcttcgtttcgataatacatatggaaaattaggcggcgcatacaatgcatataatgag
cttgctgttcgtcgtcaggtcacacgtgaaggaaaatcagaatacttcttgaatggcaca
cgatgccgccgtcgtgatattaccgatatttttttaggaactggtctaggaccacgttct
tatgcagtcattgaacagggtatgatcaatcgtttggttgatgctaaacctgaagaaatg
cgagtgtttattgaagaagctgctggcgtatctcgctatcaagcacgtcgtcgtgagact
ttgcagcatttagaacatactgagcaaaacttagcgcgtttggaagatatagcggctgaa
ttaaaatcacagctgagaacgctaaaacgccagtccgaagccgccatccaatataaaacc
ttagaaactcagattcgtactttaaaaatcgaaatactgtctttccaagcgaatcaaagt
cagaagttacaacaagaatatactgttgaaatgaacgagcttggcgaacgctttaaatta
gttcggtcagagtcgcatacaattgagcatgatttagaagcgacaagtgctttatttcaa
cgtttgattcagcaatcatcacctttgcagcatgaatggcaacaggcagagaaaaaactg
gctgaattgaaaatgactttggagcaaaagcaaagcttatttcaacaaaatagtagtagt
ttgattcagcttgaacaacaaaaacttcaaactaaagaacgactacagctttctgaactt
caggtcgaaactttaactgcacaatatgatgagcagagtgaagccttagttgaattggag
cagcaaacacaatcgaccgaacatcactttagtgatcttcaggcgcaacaaaaacaagca
caacaacaatttgaacaaattaaaacccaagttgatcagcagcaacaaaaaaagttgcaa
atggcggcacaaattgaacagcttgctaaaaatgtgcaacgaatcgaacaacaaaagcag
actttgcagaaccaaagtaatcagattcgtgctcaggttcaggatgatgagcaagcgcaa
ctagaacaattacagcagcaattacaacaagaaatcattattttagaaaccgaaatagag
caatttcaacaaaatacaaagattttgcaggatcaacaacagcaagataaaaccaatcta
cagagtttaaaaacagaaattcaagttctattggctgaacagaaaaatttgaatcaattg
ctggcgaagaagagtccaaaacaaaatcaaaatgctgttcgattgatgcaaagcttgcgc
ttaacaactcaaggcaaagctcatactgtgatcattgagaaatttttagctaaatggtta
caagcacagttgatcgaaagtggacaaacattccaagaagatgtggcacgtcagttaaaa
tcatccacgcagcaaaagattcaaatacaacaactgcgtcgtttaaatgattttattgaa
gctccacaatcttcgctctgggcaaatgttgccgttgcagatgatttaacaacagcattg
agtcatcagtctgatcttattcatgcacaatcgattttgacgcttgatggttatcatgtc
ggggctgattgggtgatcgctctgcactatgatgaagatagccaaagtgcacagggcatg
ttaagccatcaagtgcgtttagaggaaatcgaacaacaacttgcagaaatgcagccacaa
ttacttgagttagaaaaccaattttctattcaacaacaaactttgcagcaacagcaacaa
catttacagcaacagcaacaaagccaaaaacaaaagcaaaaagaattacaacaactcgat
gtgcaaattgctaaattacaaagtactgcacaggcttatgtattgcagcaacagcaattg
gcagatcaactaaaacaattggatttgcagcttgaagaagatgcgatgcagcgagatgat
ctagaaattgatctgcatgcactcgcaattaaattagaagcggtattaccgaactataaa
actttgcagtttcaggttgaaagtttaaatgagcagttagatgagcaacaacaacagttg
actcaacaacaacaacatcgtgaagtattacgccgtcagacctcgcaagccaatcagcaa
attgaattgttagagaaagatatctcgttcctgaaaacacaatatcgtcaaatcatcgaa
caaattgagcaggccaagaagtttgttgatccgattcagcttgagctgccgaacttggag
tctgaatttcacgagcaattccagcaaacagaaaagctacagaaaacatggaatgaatgg
cagcttgaattgaatcaagtacaagaaaagcagcaacaactgacagagcaacgccatcaa
gcccaacaaaaagatgaacaggtgcgtgaacagttggaacaaaaacgcttggcatggcag
gcagctaagtcagatcgtgaacattatttagaacaactcaaagaacttaattccgaacct
gtatctgatctgtcgattgaaattaaagagcatcagcaaaaactggaaaaagcacaacaa
cagtttgagaaaattggcgcagtcaatttagcagcttctcaagaatacgaagaagtgtca
cagcgttttgatgagcttagccatcagatgcaagatttgcaaaatactgttgaccaacta
aaagatgcaatgaaaagcattgatcaagaaacacgaaagctatttatgaccacctttgat
caggtcaaccaagagctacaagtattgttccctaaggtttttaacggcggtgaagctact
ttgagtcttgaggatgactggcagtcaggtgtcaaattaatggctcgaccaccaggcaaa
cgcaatagctcgctggctttgctgtcaggtggagaaaaagcactcactgctttagcttta
gtgtttgcgatctttagattgaatccagcgcctttctgcgttctagatgaagtagatgcg
ccgttggatgatgcgaatgtacaacggtattgtaatttggtaaaagagctttctgaacag
gtacaattcatttacattacacataataaattggcgatgacaatggcaactgatttattg
ggagtgaccatgccagagccaggtacatcaaaattagtgactgtcgatttagaacaggca
aaagaatacgggttagttgcggagtcctaa

DBGET integrated database retrieval system