KEGG   Acinetobacter junii: BVL33_10720Help
Entry
BVL33_10720       CDS       T04674                                 

Definition
(GenBank) chorismate mutase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
ajn  Acinetobacter junii
Pathway
ajn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ajn01100  Metabolic pathways
ajn01110  Biosynthesis of secondary metabolites
ajn01130  Biosynthesis of antibiotics
ajn01230  Biosynthesis of amino acids
Module
ajn_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BVL33_10720
Enzymes [BR:ajn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     BVL33_10720
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     BVL33_10720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT ACT_4 Osmo_CC End3 YscO
Motif
Other DBs
NCBI-ProteinID: APU48948
UniProt: A0A380UIV1
LinkDB All DBs
Position
complement(2197522..2198631)
Genome map
AA seq 369 aa AA seqDB search
MVNDGQNTSTSLNLEQIRNDIDSVDQQIQELLNRRATLAEAVAKAKFAAEENPLFYRPER
EAQVLRKVMERNQGPLSDATMARLFREIMSACLALEAPQSIAFLGPEGTYTHSAVIKHFG
KDAVVRPLPTIDEVFREVEAGGAHYGVVPVENSSEGIVNHTLDCFKSSTLNVIGEVELRI
HHQFLVSENTRKDSIKQIYAHQQTLAQCRKWLDAHYPGVERVALNSNAEAARRIRNEWHS
AAIASDIAASMYNLEILHSNIEDNPENTTRFLVIGREKIPQSGNDKTSLLISAHDRAGAL
LEILAPFAKHKISLTSIETRPALPEKWAYVFFIDLEGHIDQENVAAALDEIRPNVKELRV
LGSYPIAVL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacgatggacaaaacacatcgacgtcacttaatttagaacaaattcgtaatgat
atagatagtgttgatcaacaaatccaagaattacttaaccgtcgagctacgctggctgaa
gctgtagcaaaagcgaaatttgcagctgaagaaaacccattattttatcgtcctgaacgt
gaggctcaagttctccgtaaggtgatggaacgtaatcaaggtccattgtctgatgcgacg
atggcacgtttatttcgtgaaatcatgtccgcttgtttagcacttgaagcacctcaaagc
attgcatttttaggtcctgaaggtacatatacgcattcagctgtgataaaacattttggt
aaagatgcagttgtgcgcccattgccaacgattgatgaagtgttccgtgaagttgaagct
ggtggtgcgcattatggtgttgttccagttgagaattcatcagaaggtatcgtaaaccac
actttagattgctttaaatcatctactttaaatgtgattggtgaagtagaacttcgcatt
catcatcaatttctcgtatctgaaaatactcgtaaagacagcattaaacagatttatgca
catcaacaaacccttgctcaatgtcgcaaatggttagatgcgcattatccaggtgtagag
cgtgtagcgcttaattcaaatgcggaagctgctcgccgtattcgtaatgagtggcattct
gccgctattgcttcagatattgctgcaagtatgtataacttagagatattacatagcaac
attgaagataaccctgaaaatacgactcgtttccttgtgattggtcgcgagaaaattcca
caaagtggtaatgataaaacgtctttactgatctctgcacatgatcgtgcgggtgcttta
ttggaaatcctggcgccatttgccaaacataaaattagtttgactagtattgaaactcgt
ccagcgcttcctgagaaatgggcttatgttttcttcattgatttggaagggcatattgat
caagaaaatgtagctgcagcattagatgaaattcgacctaatgtaaaagaattgcgagta
ttgggttcatatcctatcgctgttttatag

DBGET integrated database retrieval system