KEGG   Acinetobacter junii: BVL33_10770Help
Entry
BVL33_10770       CDS       T04674                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ajn  Acinetobacter junii
Pathway
ajn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BVL33_10770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ajn01003]
    BVL33_10770
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ajn01011]
    BVL33_10770
Enzymes [BR:ajn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BVL33_10770
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BVL33_10770
Glycosyltransferases [BR:ajn01003]
 Polysaccharide
  Bacterial polysaccharide
   BVL33_10770
Peptidoglycan biosynthesis and degradation proteins [BR:ajn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BVL33_10770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: APU48956
LinkDB All DBs
Position
2208575..2210980
Genome map
AA seq 801 aa AA seqDB search
MKCERGIGFLALIFSILVIGVFIAFSIYLIRLDNIIRNKFEGQRWDIPAKVFARPLEIYA
NAPITQENFTQELKLLGYKNTSNYDKSGSYVIQGNQMYVHTRGFDYGDTTEPEQVLEVAF
IDGQVSEIRSTKPSNTGVARLEPLLIGGIYPQHNEDRVLIKLNKVPKPLIEALISTEDRN
FYQHHGVSIRGTARALVSNATGGKRQGGSTLTQQLVKNFYLSPEKTLKRKVNEALMALLI
ELHYSKDEILEAYLNEVNLGQNGNYSINGYGLASQFYFGLPLRELNISQQAFLVGLVQGP
SLYNPWRNPESAKKRRDIVLNNMLVMGYLTEAEYQDEIARPLNVVSKPTLGLAKFPDFLD
IVRRQLRTEYQENDITNQGLKIFTTLDPIAQTQVQSAFKSSVERLAGSNPSRLKNLQGAV
LVAHPENGELIAAVGSTQDFTGFNRALDAKRQVGSLLKPIIYLNAIESGRYTWATPIEDT
AVNIPIDGDKSWTPKNYSGGEHGVVPMQQALANSYNLSTVRLANEFGLSTFSNKLKQFGV
TSDIPAYPSIYLGAVNMSPMEVLSIYGNFATGGFKYPPRTIRTVVDAKGRLLERYGLNVQ
QTIDPAAAYILNYGLQQVMRSGTGRSAYSSLPESLNLAGKSGTTNDTRDSWFAGYSGNHV
AVVWLGLDDNKITGLTGSSGALPVWTNVMKQLRQEPVNLRQTDNVQWQWIDSASGDLSAQ
GCDGAMYIPLLRQTVPRRATTCGLSHYEVEPTYNPSTEDNQGNESDGISNYIRESETEMD
NDLSNHSSTRIISSGSYNGEN
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtgaacgtggtatcggttttctagcactaattttttcaattttagtgatcggt
gtatttattgcttttagtatctatttgatccgtttagataatattatccgcaataagttt
gaggggcagcgttgggatattcctgccaaagtatttgctcgtcctttagaaatctatgcg
aacgcgccgattactcaagagaattttactcaagagttgaaactcttgggctataaaaac
acttctaattacgataaatctggaagctatgttattcaaggtaatcaaatgtatgtccac
actcgtggttttgattacggtgatacaactgaaccagagcaagtgcttgaagttgcattt
atcgacggtcaagtgagtgaaattagatcaactaaaccatcaaatacgggtgttgctcgt
ttagagcctttattgattggtggtatttaccctcagcataatgaagatcgcgtactcata
aaattgaataaagtaccgaaaccgttgatcgaagcactcatttcaacagaggatcgaaat
ttttatcaacatcatggtgtctcgattcgtggtacagctcgtgctttagtgagtaacgca
actggcggaaaacgacaaggtggttcaacactaacacaacaattggtcaagaacttctac
ctttctcctgaaaaaacgctcaaaaggaaagtaaatgaagcgttaatggctttattgatt
gaacttcattacagcaaagatgaaattcttgaagcgtatctaaatgaagttaatcttgga
caaaatggcaactactcaattaatggttacggtttagcttcacaattttattttggttta
ccattacgtgaacttaatatttctcagcaagcattcctagtaggcttggttcaaggtcca
tcattatacaatccttggcgcaatccagaatcagctaaaaaacgtcgtgacatcgtatta
aataacatgttggtcatgggctatttaacagaagctgaatatcaagatgaaattgcacgt
cctttaaatgttgtaagtaaaccaactttaggccttgctaaattcccagattttcttgat
attgttcgtcgccaactacgcacagaatatcaagaaaatgatattaccaatcaaggctta
aaaatctttacgacacttgatccaatagctcaaactcaagttcaaagtgcttttaaaagc
tctgtagaacgcttagcaggtagcaacccttctcgtttaaagaaccttcaaggtgctgtt
cttgttgcccatcctgaaaatggtgagttaatcgcagctgttggttctactcaagatttt
actggatttaaccgcgcacttgatgctaaacgtcaggttgggtcattactcaaaccaatt
atctatttgaatgcaatagaatctggtcgctacacatgggctacccctattgaagatact
gctgtcaatatccctattgatggagataaaagttggacgcctaaaaactatagtggtggc
gaacatggcgtagtaccaatgcaacaggcattagcaaattcatacaacttatctacagta
cgtcttgccaatgagtttggcttatcaacctttagtaataaattaaagcaatttggagta
acttcagacattccagcttatccttcaatctatctaggtgcagtcaatatgtcaccgatg
gaggtattaagtatttatggaaacttcgctactggtggtttcaaatatccacctcgcaca
atacgcactgttgttgatgctaaaggtcgtttattagaacgatatggtctaaacgtacaa
caaacgattgaccctgctgcggcatatattttgaattatggtttacaacaagtaatgcgt
tcaggtacaggtcgttcagcatatagcagtttacctgagtctctaaatttagctggtaag
tcaggcacaacaaatgatacgcgtgactcttggttcgcaggatattctggtaatcatgtt
gcggtagtttggttaggtttagacgacaacaaaataacaggtttaacaggttcatcaggc
gctttacctgtttggacgaatgtcatgaagcaacttcgccaagaacccgtgaatttacgt
caaacagataatgttcaatggcaatggattgatagtgctagcggtgatttatctgctcaa
ggttgtgatggtgcaatgtatattcctttgcttcgccaaacagttccccgtcgagctact
acttgtggtttatcgcactatgaagttgaaccgacttacaacccatcgactgaagacaat
caaggcaatgaaagcgatggtattagtaactacattcgagaaagtgaaacagaaatggac
aatgatttatcaaatcactcctctacaagaattatttctagcggtagctacaacggcgag
aattaa

DBGET integrated database retrieval system