KEGG   Acinetobacter junii: BVL33_11555Help
Entry
BVL33_11555       CDS       T04674                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ajn  Acinetobacter junii
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BVL33_11555
Enzymes [BR:ajn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BVL33_11555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Thi4 FAD_binding_3 K_oxygenase NAD_binding_8 AlaDh_PNT_C FMO-like Spermine_synth
Motif
Other DBs
NCBI-ProteinID: APU49088
LinkDB All DBs
Position
complement(2369543..2371108)
Genome map
AA seq 521 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDESDKAAKIKELVTEIAELSDQVTARFDGSNAR
RPSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDEVLNQIKGLNLKSNF
DVFVSLSCHNCPDVVQALNLIAIYNPNATATMIDGGFFQEEVEERKILAVPMLFQDNQHI
GQGRMTLEEIIAKLDSNSAEKDAALLNAKDAFDVLVIGGGPAGGTAAIYAARKGIKTGIV
AERFGGQVMDTMDIENFTTIQKTVGPKFAQDMEAHVREYGVDIMNLQRVSKITGADQTAN
GLVEVELENGAKLESKTIILSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKLNSLPNTTVITNALSTEVVGD
GSQVTALKYKDRATDVEHTVELAGIFVQIGLLPNTDFLKNSAVELSNRGEIVINDRNETN
VQGVFAAGDCTTVPYKQIIIATGEGAKAALSAFDYMIRSTN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatattaaaactcaattaaaagcttacttagaacgtttagaaagtcca
atcgagttggtggctgctttagatgaatccgataaagctgcaaaaatcaaagaactcgtg
accgaaattgctgaactttctgatcaagttacggcgcgttttgacggttcaaacgctcgc
cgtcctagtttcggtgtggctaaagcaggtgagcaacctcgtgtgttcttcgctggtcta
ccaatgggacatgagttcacctctttgatcttggcattgttacaagtttcaggttatgca
ccgaaggtatctgatgaggttttaaaccagattaaaggcttgaacttaaaatcaaacttt
gatgtgtttgtttcgttgagttgtcacaactgtccagatgtggttcaggctttgaacctg
attgcgatctataacccaaatgcaactgcgaccatgattgatggtggtttcttccaagaa
gaagttgaagaacgcaaaatcttagcagtcccaatgttgttccaagacaatcaacatatt
ggtcagggtcgtatgactttggaagaaatcatcgcgaagttagatagtaactcagcggaa
aaagatgcagcacttctcaatgcgaaagatgcttttgatgtattggtgattggtggtggt
cctgcaggtggtacagcagcgatctatgcagcgcgtaaagggatcaaaactgggattgtg
gctgaacgttttggtggtcaagtcatggataccatggatattgaaaactttactacgatt
caaaaaacagttggtcctaagtttgctcaagacatggaagcccatgtccgtgaatacggt
gtggacatcatgaacttgcaacgtgtcagcaagatcacaggtgcagatcaaacagccaat
ggtttggttgaagttgaactagaaaatggtgctaagcttgagtctaagaccatcattctt
tcaactggtgctcgttggagagaaatgaatgttccaggtgaagctgaataccgtacacgt
ggtgttgcgtactgcccacactgtgatggtccattatttaaaggtaaacgagttgcagtg
attggtggaggtaactcgggtgtagaagctgcgattgatctagcagggattgttgagcat
gtgactttggttgagtttgataccaaacttcgtgctgaccaagtcttacaggacaagtta
aatagcttaccgaataccacagttattaccaatgctttaagtactgaagtggttggtgat
ggttcacaagtgacagcattgaagtataaagatcgtgcgactgatgtagaacacacagta
gaacttgcgggaatctttgtacaaattggtttattgccaaatacggatttcctaaagaac
agtgcagttgaactcagcaatcgtggtgagattgtgattaatgatcgtaatgagaccaat
gtacagggtgtatttgcagcaggtgactgtacgacagtaccatacaagcaaatcatcatc
gcaacaggcgaaggtgcgaaagctgcattatctgcctttgattacatgattcgttctacg
aattaa

DBGET integrated database retrieval system