KEGG   Acinetobacter junii: BVL33_12910Help
Entry
BVL33_12910       CDS       T04674                                 

Definition
(GenBank) TetR family transcriptional regulator
Organism
ajn  Acinetobacter junii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_24
Motif
Other DBs
NCBI-ProteinID: APU49332
UniProt: A0A3R9M906
LinkDB All DBs
Position
complement(2653171..2653803)
Genome map
AA seq 210 aa AA seqDB search
MQTAQQLLERLYPQRRSLLKRQILFDALSCFLEFGLDATSIEMIRERSESSVGGIYHHFK
NKEGVIAALVFAALDDQSRLRDQYLEQTQSLKELIYSLIYSYVDWVADQPEFAKFLLLAH
YSVMKGEHRSVLIEKNKLRNKTLRNYISQYSEASLLKSAPAELMMSLVIGATENYCRAWL
FEKVDTNPKIYREMLAKAAWDSLQNLAEIE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacggctcaacaattattagaaaggttgtatcctcaacgaagatctttattaaag
cgtcaaatattatttgatgcgttatcgtgttttttagagtttggattagatgccactagc
attgagatgattagagaacgttcagaaagcagtgtaggagggatctatcatcatttcaaa
aataaagagggtgtaattgccgctttagtgtttgcagctttagatgatcaatcaagatta
agagatcaatacttagagcagacgcaatctttaaaagaactgatctatagcttgatttat
agttatgttgattgggttgctgatcagccagagttcgctaaatttttattacttgcacat
tacagtgtgatgaaaggtgaacaccgttcggttctaattgaaaagaataagctcagaaat
aaaacgctacgcaactacatttcacagtattctgaagcatctttattgaaatcagctcca
gcagagttaatgatgtctttagtgattggtgcaacagaaaactattgccgtgcttggtta
tttgaaaaggttgatacgaatccgaaaatttatcgggaaatgttggctaaagctgcatgg
gattctttacaaaacttagctgagatagagtga

DBGET integrated database retrieval system