KEGG   Acinetobacter junii: BVL33_13000Help
Entry
BVL33_13000       CDS       T04674                                 

Definition
(GenBank) DUF962 family protein
Organism
ajn  Acinetobacter junii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF962
Motif
Other DBs
NCBI-ProteinID: APU49349
UniProt: A0A380UGL4
LinkDB All DBs
Position
complement(2681562..2681933)
Genome map
AA seq 123 aa AA seqDB search
MNAPAKIDKPVEFTLPIKDYNEFYRFYLTEHRSIASRRLHVAGSTLGLYFWSKAIRQRKA
KYLAYGLLSGYACAWVGHFFFEHNKPASFKQPLYSFISDWRMLSDVVRGRLSLIDRQFDK
IES
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaccagcgaagatcgataagccagtagaattcacattgccaattaaagactat
aatgaattttaccgcttttatttaactgaacatcgtagtattgcgagccgacgtttgcat
gtagcaggtagtacactgggtttgtatttttggagtaaagcaattcgccagcgtaaagca
aagtatttagcttatggtttattgtctggatatgcgtgtgcatgggttggacacttcttt
tttgaacacaataagccagcgagctttaaacaaccactttatagttttatttcagattgg
cgtatgttgtctgatgttgtgcgcggtcgtctaagtttaattgaccgtcagtttgataaa
attgaatcttaa

DBGET integrated database retrieval system