KEGG   Acinetobacter junii: BVL33_13050Help
Entry
BVL33_13050       CDS       T04674                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ajn  Acinetobacter junii
Pathway
ajn00020  Citrate cycle (TCA cycle)
ajn00480  Glutathione metabolism
ajn01100  Metabolic pathways
ajn01110  Biosynthesis of secondary metabolites
ajn01120  Microbial metabolism in diverse environments
ajn01130  Biosynthesis of antibiotics
ajn01200  Carbon metabolism
ajn01210  2-Oxocarboxylic acid metabolism
ajn01230  Biosynthesis of amino acids
Module
ajn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ajn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVL33_13050
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BVL33_13050
Enzymes [BR:ajn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BVL33_13050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: APU49359
LinkDB All DBs
Position
complement(2693245..2695476)
Genome map
AA seq 743 aa AA seqDB search
MAGGKSKIIYTLTDEAPLLATYSLLPIIETFTKPAGIEIVKSDISVAARVLAEFSDYLSD
EQKVANNLAELGRLTQDPDTNIIKLPNISASVAQLTACIKELQSKGYAIPDYPENPTTDE
EKEIKTRYGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMTEWKQWSQTHVSHMEE
GDFYHGEKSMTLDRARNVKMELITKRGETIVLKPKVALQDGEVIDSMFMSKKALCDFYEK
QLDDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDQLGINVNNGMA
GLYEKIATLPTSLREEIIEDLHACQEHRPALAMVDSAKGIDNFHSPNDVIVDASMPAMIR
GGGKMWGADGKPYDCKAVMPESTFARIYQEMINFCKWNGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIPEAGIANITDLDTGEVLMSQNVEEGDIWRMCQVKDAPIRDWVKLAVSRA
RNSGMPAIFWLDPYRPHENELIKKVEKYLKEHDTEGLDIQIMSQVRAMRYTLERVARGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEELGLKEDNARAKLLAKTLDQATGKLLDNDKSPSRRTGELDNR
GSHFYLAMYWAEALAAQDEDAELKAKFAPLAKALVENEQKILAELSEVQGKAADIGGYYA
VDPVKVNAVMRPSSTFNATLETI
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggctggtggaaagtcaaaaatcatttatacactgactgatgaggcgccgttattggcg
acctactcgctactgccgatcattgagacctttactaagccagctggcatagaaattgtc
aagagtgacatttctgttgcagcgcgtgtgcttgcagaattttcggactacttaagtgat
gagcagaaggtggctaacaaccttgcagagcttggtcgccttactcaagatccagatacg
aatatcatcaaactgccgaatatcagtgcgtctgttgctcaattgacagcatgtatcaaa
gagttacagtccaaaggatatgcaattcctgattatccagaaaaccctactacggatgaa
gagaaagaaatcaagactcgttacggtaaatgtcttggttctgctgtaaaccctgtattg
cgtgaaggtaactcagatcgtcgtgcgcctgctgctgttaaaaactatgcgaagaagcat
ccacattcgatgactgaatggaaacagtggtctcaaacccacgtatcacacatggaagaa
ggtgacttctatcatggtgaaaaatcaatgacgcttgatcgtgcacgtaacgtgaagatg
gaattgattactaagcgtggtgaaacgattgttctgaaaccgaaagtagcacttcaagat
ggcgaagtaattgattcaatgttcatgagcaaaaaagcattgtgtgacttctatgagaag
caactcgatgattgccgtgaagcaggtattttattctcgttacacgtaaaagccacaatg
atgaaagtttcacacccgatcgtttttggtcactgtgtgaaaatttactacaaagaagca
tttgagaaacacggtaagttatttgatcagttaggtattaacgtcaataacggtatggct
ggtctttatgaaaagatcgctactttaccaacctcacttcgtgaagaaatcattgaagat
ttacatgcttgccaagaacatcgccctgcattagcaatggttgactcagcaaaaggcatc
gacaacttccattcaccaaacgatgtaattgtagatgcttcaatgcctgcaatgattcgt
ggtggcggtaaaatgtggggtgcagatggtaaaccttacgattgtaaagcggtaatgcca
gaatcgaccttcgcacgtatctaccaagaaatgatcaatttctgtaagtggaatggtaat
tttgatccgaaaacgatgggtactgtacctaacgttggtttgatggctcaaaaagcagaa
gaatacggttcacacgataaaacatttgaaattcctgaagctggtattgcgaacattaca
gatttagacacgggtgaagtactgatgtctcaaaatgtagaagaaggcgatatctggcgt
atgtgtcaggtgaaagatgcaccgattcgcgattgggtaaaacttgcagtaagtcgtgcg
cgtaactctggtatgcctgcaattttctggcttgacccatatcgtccacacgaaaatgag
ttgatcaagaaagttgagaagtacttaaaagagcatgacactgaaggtttagacattcag
atcatgtcacaagtacgtgcaatgcgttatacgcttgaacgtgtagctcgtggtttagat
actatttctgtaactggtaacattttacgtgactatttaactgacttgttcccaatcatg
gagttgggtacttcagcgaaaatgttgtctatcgttccgttaatggcgggcggtggcatg
tatgaaacaggtgcaggtggttcagcgccgaaacatgttcagcagttagttgaagaaaac
cacttacgttgggattcgctaggtgaattccttgcgcttgcagtatctttagaagagcta
ggtcttaaagaagataatgcacgtgctaaattgctagcgaaaacacttgatcaagctacg
ggtaaactgctcgataacgataagtctccatcacgtcgtactggtgagctagataaccgt
ggtagtcatttctatttagcaatgtattgggctgaagcacttgctgctcaagacgaagat
gctgagttaaaagcgaagtttgctcctcttgcaaaagctttagttgaaaatgagcaaaaa
attcttgctgaattgagtgaagtacagggtaaagcagctgatattggtggttactacgct
gtggatccagtaaaagtaaatgcagtaatgcgtccaagttcaacttttaatgctacgctt
gaaacgatttaa

DBGET integrated database retrieval system