KEGG   Acinetobacter johnsonii: RZ95_08735Help
Entry
RZ95_08735        CDS       T04178                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K21417  acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta [EC:1.1.1.-]
Organism
ajo  Acinetobacter johnsonii
Brite
KEGG Orthology (KO) [BR:ajo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RZ95_08735
Enzymes [BR:ajo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     RZ95_08735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: ALV72967
UniProt: A0A0U3T6U8
LinkDB All DBs
Position
complement(1783196..1784215)
Genome map
AA seq 339 aa AA seqDB search
MPNKSYRNAIKEAIELEMRRDPSVIVVGEDVRGGHGGKNTDDNKLEGFGGVLGVTKGLWT
EFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCYDMLYNQAAKFRYMFG
GKAKAPLVVRGMIGAGFSAAAQHSQSPYNVFASVPGLKVVVPSSAYDVKGLLIQAIRDDD
PVVFCEHKLLYDIKGEVPDEAYTIPFGVANYTREGTDITIIALSLMVHRANEVADKLAKE
GISVEVVDPRTISPLDEDGILESVASTGRVVIVDESAARCGFGHDVAALIAQKGFHYLKA
PIELVTPPHSPVPFSPVLEKEWLPSVERIEQAVRKTLEA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgccaaataaaagttatcgaaacgcaattaaagaagcaattgaattagaaatgcgccga
gacccaagtgtcattgtggttggtgaagatgttcgtggtgggcatggtggcaaaaatacc
gatgacaataaactggaaggttttggcggtgtgcttggcgtgaccaaaggcttatggact
gaatttggttctgagcgagtcattgatactccaattacagaatctgcgattattggtatg
gcggcaggtgctgctgcaacgggtttaagacctgtggcagatttaatgttcatggatttt
tacggcgtgtgttatgacatgctgtataaccaagcggctaaattccgctatatgtttggt
ggcaaagccaaagcgccactcgttgtacgtggcatgattggtgcaggtttttctgcagca
gcacagcattctcagtcgccatataacgtatttgcctcagtgcctggtttaaaagtggtg
gtgccttcgagcgcctatgatgtgaaagggttgttgattcaagccattcgagatgatgac
ccagtagtcttttgtgaacacaagttgttatatgacattaagggcgaagtaccagatgag
gcctacaccattccttttggtgtcgcaaattacacccgtgaaggcacagatatcaccatt
attgccttaagtttgatggtgcatcgtgccaatgaagtcgctgataagctcgcaaaagaa
ggcatttcggttgaagtggttgaccctagaaccatttcaccattagacgaagatggcatt
ttagagtcagtagcttcaacaggtcgtgtggtgattgtagatgaatcagcagcacgttgt
ggtttcggacatgatgtggctgcgcttattgcccagaaaggctttcattatcttaaagca
ccaatcgaattagtcactccaccacactcacccgtaccattttcaccagtactagaaaaa
gaatggctacctagtgtagaacgcatcgaacaggctgtacgcaagacgttggaggcttag

DBGET integrated database retrieval system