KEGG   Acinetobacter johnsonii: RZ95_09890Help
Entry
RZ95_09890        CDS       T04178                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ajo  Acinetobacter johnsonii
Brite
KEGG Orthology (KO) [BR:ajo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RZ95_09890
Enzymes [BR:ajo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RZ95_09890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored NAD_binding_7 FAD_binding_3 K_oxygenase Thi4 AlaDh_PNT_C FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ALV73172
UniProt: A0A0U3A4L4
LinkDB All DBs
Position
2006113..2007678
Genome map
AA seq 521 aa AA seqDB search
MLDQNTSAQLKTLLERLEGPIELVATLNRSEKSDKIKELVEEVAALSPLVTARFDGQNSR
APSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQTSGYAPKVSDEVLASIKALGIQSDF
DVFVSLSCHNCPDVVQALNLIAIYNPGTTATMIDGAFFQDEVEERKIMAVPMVFQDNNHI
GQGRMTLEEIIAKLDTNSAAKEAEKLNAKDAFDVLVIGGGPAGNTSAIYAARKGIKTGIV
AERMGGQVMDTMDIENYTSIQKTQGPKFAAEMEAHVREYGVDIMNLQRVSNIKGADETAN
GLVEVTLENGAKLESKTVILSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKLHSLPNTTVILNALSTEVVGD
GSQVTALKYKDRATDVEHTVELAGIFVQIGLLPNTDFLKETAVELSNRNEIMINDRNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatacttcagctcaattaaaaacacttcttgaacgcctagaaggtccg
attgaattggttgcgactttgaaccgttctgagaaatcagacaaaattaaagaattggtt
gaagaagttgcagcactgtctccactggtgactgcacgttttgatggtcaaaactcacgt
gcacctagctttggtgtagcaaaagccggtgaacaaccacgtgtgttctttgcgggttta
ccgatgggacatgagtttacctctttgatcttggcattgttacagacctcaggttatgca
cccaaagtatctgatgaagttttggcctcaatcaaagctttgggcatccagtctgacttt
gacgtatttgtctctttaagctgtcataactgcccagacgtggtgcaagcgttgaacctg
attgccatttacaatccgggcacgacagcaaccatgattgatggtgcattcttccaagac
gaagtcgaagagcgcaaaattatggctgtaccgatggtgttccaagacaataaccatatc
ggtcaaggccgtatgaccttggaagaaattattgccaaactggataccaattccgctgcc
aaagaagctgaaaaactcaatgccaaagatgcttttgatgttttagtgattggtggtggc
cctgcaggaaatacctctgccatctacgcagcacgtaaaggcattaaaacagggatcgtg
gctgaacgtatgggtggtcaagtcatggataccatggacattgaaaactatacctcgatt
caaaagactcaagggccgaagtttgctgctgaaatggaagcacatgtacgtgagtacggt
gtggacatcatgaacttacaacgtgtttctaacatcaaaggtgcggatgagacagcaaat
ggcttggttgaagtcactttagaaaatggtgcgaagcttgaatctaaaacagtgattctt
tcaacaggtgcacgttggagagaaatgaatgtgccaggcgaagcagaataccgcactcgt
ggtgttgcttactgtccacactgtgatggtccactgtttaaaggcaaacgtgtagcagta
attggcggggggaactcaggtgtcgaagctgcgattgatcttgctgggattgttgaacat
gtaactttggttgagtttgataccaaactacgtgccgaccaagtgttgcaagacaaattg
catagcttgcctaacactacggtgatcctgaatgcactctcgaccgaagttgtgggtgat
ggttcacaagtgacggcattgaaatataaagaccgtgcaactgatgtagaacatacggtt
gagcttgcaggaatctttgtgcaaattggtttattaccaaacactgatttcttaaaagag
actgctgttgagctttcaaaccgtaatgagattatgattaacgatcgcaacgaaaccaat
gtcaaaggtgtatttgccgcaggtgactgtacgactgtgccatacaagcaaatcatcatt
gccacaggtgaaggcgcgaaagcatctctatctgcttttgattatattattcgttctggc
gtgtaa

DBGET integrated database retrieval system