KEGG   Acinetobacter johnsonii: RZ95_12800Help
Entry
RZ95_12800        CDS       T04178                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ajo  Acinetobacter johnsonii
Pathway
ajo00473  D-Alanine metabolism
ajo01100  Metabolic pathways
ajo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ajo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RZ95_12800
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    RZ95_12800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ajo01011]
    RZ95_12800
Enzymes [BR:ajo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RZ95_12800
Peptidoglycan biosynthesis and degradation proteins [BR:ajo01011]
 Precursor biosynthesis
  Racemase
   RZ95_12800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DevR
Motif
Other DBs
NCBI-ProteinID: ALV73663
UniProt: A0A0U3SWL4
LinkDB All DBs
Position
complement(2621472..2622698)
Genome map
AA seq 408 aa AA seqDB search
MKKATLWVCMLGTGLLHIQSSFAAPLLTPHLSATQVAAPQANAWVEINVQTFEQNIQTLQ
QQLQDKSQICAVMKADAYGHGIELLMPSIMKLNVPCVGITSNAEAAMVRKSGYQGRLLRL
RAATDQEIQNAASLNMEELLGNYEQAQRLSVWAKQQGLTLAYHLGLNAGGMDRNGLELDS
ALGKQQALRMTKLLNLKLVGIMTHYAVEDEKYVRERLAVFNQQTDWIIKKAKLKREALTL
HTANSFATLTVPESHLDMVRAGGVIYGDSLPDRAEYKKLMTFKTQVATVNAYLKGTTVGY
DQTYTLKRDSLLANLPLGYSDGYRRAFSNKAYVLIRGHKVPVVGRTSMNTSMVDVTDFPD
IRANDEVVLFGEQRGATVKQSDLEEYNGALLADVYTMWGNSNPKVVVK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagcgacactttgggtatgcatgttgggtacaggattactacatatacagagc
agttttgccgcaccgttattgacgccacatctttcagcgacacaagtggcagcaccacag
gccaatgcatgggtcgaaattaatgtgcagacctttgagcagaatattcagaccttacaa
cagcagctacaggacaaaagccagatttgtgcggtcatgaaagccgatgcttatggtcat
gggattgaactgttgatgccgagtattatgaaacttaatgtaccctgtgttggtatcacc
agtaatgctgaagcagcgatggtgcgcaagtctggttatcaggggcgcctattaaggcta
cgtgctgcgactgatcaagaaatccaaaatgctgcttccttaaacatggaagagttgttg
gggaactatgaacaagcacagcgcctctcagtatgggccaaacaacaaggtttaaccctt
gcgtatcatttgggtttaaatgcagggggtatggaccgaaacggtttagagctggacagt
gcactaggtaaacagcaagcgctacgcatgaccaaactgctaaatttaaagctggtgggc
atcatgacgcattatgctgtggaagatgaaaaatatgtacgtgaacgtttggcggtcttt
aaccagcaaacggactggataattaaaaaagccaaattaaagcgagaagcactgacttta
cataccgcaaattcttttgcgaccttgacggttccagagtcacacctagatatggtacgt
gcaggcggtgtgatttatggtgacagcctgccagatcgagctgaatataaaaagctgatg
acctttaaaactcaagtggcaacagtcaatgcctatttgaaaggcacaacagttggctat
gaccaaacgtatactttgaagcgtgattcactattggcgaacttaccacttggttactca
gatggttatcgacgtgcatttagtaataaagcctatgtgttgattcgtgggcataaagtg
cctgtagttgggcgcacctctatgaacacttccatggtggatgtcactgattttccagat
attcgtgccaatgatgaagtggtcctgtttggcgaacaaaggggtgcaacagtgaagcaa
agtgatttggaagaatacaatggcgctttgctggcagatgtctacaccatgtggggtaac
tctaatccgaaagttgtggtgaaataa

DBGET integrated database retrieval system