KEGG   Acinetobacter johnsonii: RZ95_14435Help
Entry
RZ95_14435        CDS       T04178                                 

Definition
(GenBank) multidrug DMT transporter permease
Organism
ajo  Acinetobacter johnsonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA EmrE
Motif
Other DBs
NCBI-ProteinID: ALV73945
UniProt: A0A0U3IEV2
LinkDB All DBs
Position
complement(2971145..2972050)
Genome map
AA seq 301 aa AA seqDB search
MNALLYALVVVIWGTTWIAISLQQQSGISPNVAVFWRFFISALVLFAFVVLCRKLQKLAV
KDHLFCMLQAYCIFGFNFVCFYYAVQYISSGLEAVIFSMAVIFNTLNAKLFFGQQVSTRF
YPAALLGGLGIIALFWHDVIGSTLNNHTLMGIGLCVLGTYGFSLGNMISARHQKQGLDIF
TTNAYGMLYGSILMALIAGFKQDEFFPAMEFSAVSALLYLAIFGSVIGFTAYFYLVGRIG
AGKAAYSTLLFPLVALVISTIWEGYQWHMNAVIGVILILCGNAIFFTQTPKFRLSQMLKR
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgctgttatatgctttggtggttgtaatttgggggacgacatggattgcgatt
agtttgcaacaacaaagtggaatatcgcccaatgtagccgtattttggcgcttttttatt
tcggctctggtgttgtttgcttttgttgtgttgtgccgaaaactgcaaaagctggctgta
aaagatcatctgttttgtatgttacaagcatactgtatttttggttttaactttgtttgt
ttctattatgcggttcaatatatcagcagcggtttggaggctgttattttttcgatggcg
gtcatttttaataccctcaacgctaaactgttctttggacaacaggtttctacccgtttt
tatcctgcggctttattgggtggattggggatcatcgccttgttttggcatgatgtgata
gggagtaccttaaataatcatacgctgatggggattggcctttgtgtgttaggaacctat
gggttttcactgggcaatatgatcagtgcgcgtcatcaaaaacaaggtctggatattttt
acaaccaatgcttatggcatgttgtacggttcaattctgatggcattgattgctggattt
aaacaagacgagtttttccccgctatggaattcagtgcggtgagtgctttattgtatttg
gctatttttggttcagtgattggctttaccgcctacttctatttggttggacggattggt
gcgggtaaggcagcttatagtactttgttatttcctttggtggctttggtgatttcgacc
atctgggaaggctatcaatggcatatgaatgcggtgattggggtgattttgattttatgt
ggtaatgcaattttctttactcaaacgcctaagtttagactgagtcaaatgttgaagcga
agctga

DBGET integrated database retrieval system