KEGG   Acidovorax sp. JS42: Ajs_0023Help
Entry
Ajs_0023          CDS       T00455                                 

Definition
(GenBank) Glutathione S-transferase, C-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Ajs_0023
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ajs02000]
    Ajs_0023
Enzymes [BR:ajs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Ajs_0023
Transporters [BR:ajs02000]
 Other Transporters
  Pores ion channels [TC:1]
   Ajs_0023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N_2 GST_N_3 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: ABM40279
UniProt: A1W204
LinkDB All DBs
Position
complement(26068..26676)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIVLHEAGLAHTSVLASTKSHKLQDGTDYYTINPLGYVPVLELNDG
TRLREGPAIVQYLADQAPHKNLAPANGTLARYRLQEWLTFIGTEIHKGFSPLFKPTTPAD
YKSLVHEQLLSRLKWVDGELAHKPYLMGEHFSVADAYLFTVTNWAPAVNLDISALKNLAA
YRERIAARPAVQAAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactcccctggcgcctgctcgctctccccgcacatcgtgctgcacgaa
gccggcctggcccacacctcggtgctggccagcaccaagagccacaagctgcaggacggc
accgactactacaccatcaaccccctgggctacgtgccggtactggagctgaacgacggc
acgcgcctgcgcgaaggccccgccatcgtgcagtacctggccgaccaggcgccgcacaag
aacctcgcccccgccaacggtacgctggcgcgctaccgtctgcaggagtggctgaccttc
atcggcaccgagatccacaagggcttcagccccctgttcaagcccaccactcccgcagac
tacaagtccctggtgcatgagcaactgctcagccgcctcaagtgggtggacggcgaactg
gcccacaagccctacctcatgggcgagcacttcagcgtggccgacgcctacttgttcacg
gtgaccaattgggcccccgccgtgaacctggacatctccgcactgaagaacctggcggcc
taccgcgaacgcatcgccgcccgccccgccgtgcaggccgccatgaaggccgagggcctg
ctcaagtaa

DBGET integrated database retrieval system