KEGG   Acidovorax sp. JS42: Ajs_0311Help
Entry
Ajs_0311          CDS       T00455                                 

Definition
(GenBank) DNA ligase (ATP)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs03030  DNA replication
ajs03410  Base excision repair
ajs03420  Nucleotide excision repair
ajs03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Ajs_0311
   03410 Base excision repair
    Ajs_0311
   03420 Nucleotide excision repair
    Ajs_0311
   03430 Mismatch repair
    Ajs_0311
Enzymes [BR:ajs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Ajs_0311
    6.5.1.6  DNA ligase (ATP or NAD+)
     Ajs_0311
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Ajs_0311
DNA replication proteins [BR:ajs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Ajs_0311
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Ajs_0311
DNA repair and recombination proteins [BR:ajs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Ajs_0311
   NER (nucleotide excision repair)
    Other NER factors
     Ajs_0311
   MMR (mismatch exicision repair)
    Other MMR factors
     Ajs_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DUF3048 mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ABM40565
UniProt: A1W2U0
LinkDB All DBs
Position
316483..318162
Genome map
AA seq 559 aa AA seqDB search
MQAFAALYQALDASTSSLAKQAALRDYLRGAPPEDAAWAVYFLAGGKPRQLVPTKLLRAV
AREAAGLPEWLFDESYEAVGDLAETIALLLPPPTQAHALGLAAWMREHLLPLRGLAPDTQ
AERLGAQWARLAPEERLVYFKLITGAFRVGVSRLQVTQALAAVSGVDAKRIAQRLMGYTH
VGAQPGAADYQRLVAPQGDSAGAQAAEAQGHPYPFFLAHPLQLPVAQFDAALGPPADWIV
EWKWDGIRAQLVRRAGATWLWSRGEELVTDRFPELQALGDEALPDGTVLDGEIVVWQPER
ADAPAQPRPFADLQKRIGRKSLGPKLLREVPVVLLAYDLLEEHGQDLRGLPLQARRARLD
ALLARTDHPALVPSPVLQGQSWAELARLRDSARALGVEGMMLKGRTAHYGVGRTRDVGIW
WKWKIDPMSVDAVLIYAQRGHGRRASLYSDYTFAVWSAPQGTEGRTLVPFAKAYSGLTDA
EMARVDAIIRKTTVESFGPVRSVRPTLVFELGFEGIARSARHKSGIAVRSPRMLRWREDK
PVDEADSLDTLAALLPATP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcctttgccgcgctctaccaggcgctggatgccagcacgtccagcctcgccaag
caggccgcgctgcgcgactatctgcggggtgcgccacccgaggatgccgcctgggccgtc
tacttcctcgcgggtggcaaaccacgccaactcgtgcccaccaagctgctgcgcgcggtg
gcgcgcgaggcggcggggttgccggaatggctgttcgacgaaagctacgaggctgtgggc
gatctggccgagaccatcgcactgctgctgcccccgcccacgcaggcacacgccctgggg
ctggccgcatggatgcgcgaacacctcttgccgctgcgcggcctggcgcccgacacccag
gctgaacggctgggtgcgcaatgggcgcggctggctcccgaggagcggctggtgtacttc
aagctcatcacgggggccttccgcgtgggcgtgtcgcgcttgcaggtcacgcaggcgctc
gcggccgtgagcggcgtggacgccaagcgcatcgcccagcgcctcatgggctacacgcac
gtgggcgcgcagcccggggcggctgactaccagcgcctcgtggcgccccagggagacagt
gcgggcgcgcaggctgcggaggcccagggccatccctatcccttctttctggcgcacccg
ctgcagctgccggtggcgcagtttgacgccgcgctcggcccgccggcggactggatcgtg
gaatggaagtgggacggcatccgcgcccagctcgtgcggcgcgctggcgccacttggctg
tggtcgcgcggggaggagctggtgaccgatcgcttccccgaactgcaggcgctgggcgac
gaagccctgcccgacggcacggtgctcgacggcgagatcgtcgtctggcagcctgagcga
gcggatgcgccggcgcagccgcgcccgtttgccgacctgcaaaagcgcatcggccgcaag
tcgctgggccccaagctgctgcgcgaggtgcccgtggtgctgttggcctacgacctgctg
gaggagcacggccaggacctgcgcggcctgccgctgcaggcgcggcgcgcgcggctggac
gcgctgctggcgcgcaccgaccacccggcgctggtgcccagcccggtgctgcagggacag
agctgggcagaactggcccgcctgcgggacagcgcgcgtgccctgggcgtggagggcatg
atgctcaaagggcgcacggcgcactatggtgtgggccgcacgcgggacgtgggtatctgg
tggaagtggaagatcgacccgatgagcgtggacgccgtgctcatctatgcgcagcgcggc
catgggcgccgcgccagcctgtacagcgactacacgttcgccgtgtggagtgcgccgcag
ggcaccgaggggcgcacgctggtgccgtttgccaaggcgtattcgggcctcaccgatgcc
gagatggcgagggtggacgccatcatccgcaagaccacggtggagagcttcggcccggtg
cgcagcgtgcggcccacgctggtgttcgaactgggttttgagggcatagcgcgcagcgcg
cggcacaagagcggcatcgccgtgcgctccccgcgcatgctgcgctggcgtgaagacaag
ccggtggacgaagccgattcgctggatacgctggcagcgctgttgcctgctacgccctga

DBGET integrated database retrieval system