KEGG   Acidovorax sp. JS42: Ajs_1275
Entry
Ajs_1275          CDS       T00455                                 

Definition
(GenBank) putative secreted protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: DUF2859
Other DBs
NCBI-ProteinID: ABM41499
UniProt: A1W5H4
LinkDB
Position
complement(1351647..1352195)
AA seq 182 aa
MTKPHPAHLAFTGLLMLLSGLPLASRAGEPLIVVEDRGGTSALPYYEALNLQPRANAPAR
PPIPTPRVPATPADEAAMLPVRSAKLTPGTVARRVIEAPGLRPFVVIGDDEASRAWLQRR
AAALRERGVVGLVVNVETAQGLARLRALVPGVPLAPVAGDDLAERLGLQHYPALITATGI
EQ
NT seq 549 nt   +upstreamnt  +downstreamnt
atgacgaaaccccatcccgcccatctcgcgttcacgggcctgctcatgctgctgtcaggc
ctgccgctggcctcgcgtgccggcgagccactgatcgttgtcgaggaccgcggcggcacg
tcggcgctgccgtactacgaagccctgaacctgcagccgcgcgccaacgcaccggcgcgg
ccgcccatcccgacgccccgggttcccgccacgccagcggacgaagccgcgatgctgccg
gtgcgcagcgccaagctcacgcccggcaccgtcgcgcgacgggtgattgaagcgcccggc
ctgcggccgttcgtggtcatcggcgacgacgaggcttcccgggcctggttgcagcgccgc
gccgccgctttgcgtgaacgcggcgtggtcggcctggtggtcaacgtcgagaccgcgcag
ggcctggcgcggctgcgcgccctggtgcctggcgtaccgctcgcgcccgtggccggcgac
gacctggccgagcgcctgggcctgcagcactacccggcgctgatcacggccaccggcatc
gagcaatga

DBGET integrated database retrieval system