KEGG   Acidovorax sp. JS42: Ajs_2057Help
Entry
Ajs_2057          CDS       T00455                                 

Definition
(GenBank) superoxide dismutase, copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ajs  Acidovorax sp. JS42
Brite
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ajs_2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: ABM42233
UniProt: A1W7K8
LinkDB All DBs
Position
2166815..2167342
Genome map
AA seq 175 aa AA seqDB search
MSLRYLPTGAALAAAIALAGCASLSSAPSATARLEPTRGNSTQGTVRFVQSGDAVRVSGT
VSGLKPGAEHGFHIHEKGDCSSGDGNSAGGHFNPTGTPHGQHGKGPHHTGDLPSLRADGN
GVATFNFESRSIRVGSGATDIVGRGLIVHANPDDYVTQPTGNAGARLACAVIAGR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttcgctacctccccacgggcgcggccctggcggctgccatcgcactcgccggc
tgcgcatccctgtccagcgcgccctcggccaccgcccggctggagcctacgcgcggcaac
agcacccagggcacggtgcgcttcgtgcagagcggtgatgcggtgcgcgtcagcggcacg
gtcagcgggctcaagccgggggcggagcacgggtttcacattcatgagaaaggcgactgc
tccagcggggacggcaacagcgcgggcggccacttcaatcccacgggcacaccgcatggc
caacacggcaagggaccgcaccacaccggcgacctgcccagcctgcgcgcggacggcaac
ggcgtggccaccttcaacttcgagtcgcgcagcattcgcgtgggctccggcgccaccgac
atcgtgggtcgcggcctgatcgtgcatgccaaccccgacgactacgtcacccaacccacc
ggcaacgcgggcgcgcgcctggcgtgcgcggtgatcgccggtcgctga

DBGET integrated database retrieval system