KEGG   Acidovorax sp. JS42: Ajs_2209
Entry
Ajs_2209          CDS       T00455                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: DUF2859 DUF2384
Other DBs
NCBI-ProteinID: ABM42374
UniProt: A1W7Z9
LinkDB
Position
complement(2344496..2345029)
AA seq 177 aa
MNHIVLIATIGLLPTTTVFAQTASAPLIVVEDRGGDSALPYYQSLNPQPDQATPPAPMPA
PRVGNAADAEAAMLPVRSTQLSPGEVQRRVNRAPGLTALFLIGDDERSRAWLRQRQTALR
ELQAVGLVVNVESMAALTALRSLAPGLSLSPASGDDLAQRLGLRHYPVLITSTGVEQ
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaaccacatcgtcctcatcgccaccatcgggctgctgcccacgaccaccgtcttcgcg
cagaccgcctctgcgccgttgatcgtcgtcgaagaccgcggcggcgactccgcgctgccg
tactaccagtcgctgaatcctcagccggatcaggccacaccgccggccccgatgccggcc
cctcgcgtgggcaatgcggccgacgccgaagccgccatgctgccggtgcgctcgacgcaa
ctgtcgccgggcgaggtgcagcgccgcgtcaaccgggcgccgggcctgacggcgctgttc
ctgatcggcgacgacgagcgttcgcgcgcctggctgcggcagcggcagaccgcgctgcgc
gagctgcaggccgtgggcctggtggtcaacgtggagtcgatggccgcgctgacggcgctg
cgcagcctggctcccggcctgagcctctcgccggcctccggcgacgacctggcccagcgc
ctgggcctgcgccactacccggtgctcatcacgtccaccggcgtcgagcagtag

DBGET integrated database retrieval system