KEGG   Acidovorax sp. JS42: Ajs_2881Help
Entry
Ajs_2881          CDS       T00455                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ajs  Acidovorax sp. JS42
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ajs_2881
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Ajs_2881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like GIDA Thi4 AlaDh_PNT_C Glutaredoxin DAO FAD_binding_3 NAD_binding_7 NAD_binding_8 K_oxygenase DSBA Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ABM43022
UniProt: A1W9U7
LinkDB All DBs
Position
complement(3053048..3054604)
Genome map
AA seq 518 aa AA seqDB search
MLDANLQAQLKAYLERLQRPVELVATLDDGATSQELRELLQEIRSLSDKITVVEKNDAPV
RKPSFLITNPGVDTGVRFAGVPLGHEFTSLVLALLQVGGHPSKESADLLEQVKNLDGDFH
FETYYSLSCHNCPDVVQALNLMSVLNPRITHTAIDGAVFQDEIKERQIMGVPTVFLNGKN
FGQGRMELAEIVAKIDSGAHARVAAKLNAMEPFDVLVVGGGPAGAAAAVYAARKGIRTGV
VAERFGGQVLDTVDIENYISVSKTEGPKFAIALEQHVNDYDVEVMNLQRAKALKPAATEG
GLVEIELDNGATLKSKTVILSTGARWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKDVAV
IGGGNSGVEAAIDLAGIVKSVTVLEFASELKADGVLQKKLRSLPNVTVILNAQTTEVNGD
GSKVTGLTYKDRTTDEAKTVAVEGIFVQIGLLPNTDWLKGTVDLTRFGEIIIDARGHTNV
PGVFAAGDCTNVPYKQIIIAAGAGATAALSAFDHLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacctccaagcccaattgaaagcctatctggagcgcctgcagcgcccg
gtggagctggtcgccacgctggacgatggcgccacttcccaagagctgcgggaactgctc
caggagatccgctctctctccgacaagatcaccgtggtcgagaagaacgacgcgcccgtg
cgcaagccgtccttcctgatcaccaaccccggcgtggacaccggcgtgcgtttcgcgggc
gtccccctgggccatgagttcacctcgctggtgctggcgctgctgcaggtgggcggccat
ccctccaaggaatcggcggacctgctggagcaggtgaagaacctggacggcgatttccat
ttcgagacgtactactcgctgtcctgccacaactgccccgacgtggtccaggcgctgaac
ctgatgagcgtgctcaacccgcgcatcacgcacacggccatcgacggcgccgtgttccag
gacgagatcaaggaacgccaaatcatgggcgtgcccaccgtgttcctgaacggcaagaac
ttcggccagggccgcatggagctggcggagatcgtggccaagatcgacagcggcgcccat
gcccgcgtggccgccaagctcaatgccatggagccgttcgacgtgctggtggtcggcggt
ggtcccgccggtgccgcggccgccgtgtatgcggcgcgcaagggcattcgtaccggcgtg
gtggccgagcgcttcggcggccaggtgctggatacggtggacatcgagaactacatctcg
gtcagcaagaccgagggccccaagttcgccatcgcgctggagcagcacgtgaacgactac
gacgtcgaggtgatgaacctgcagcgcgccaaggccctcaagcccgccgcaacggaaggc
ggcctggtggaaatcgaactcgacaacggcgcgacgctcaagagcaagaccgtgatcctg
tcgaccggcgcgcgctggcgcaacatgaacgtgccgggcgaggagcagtaccgcaccaag
ggcgtgacgtactgcccgcactgcgacggcccgctgttcaagggcaaggacgtggcggtc
atcggcggcggcaactcgggcgtggaggccgcgatcgacctcgcgggcatcgtcaagagc
gtgacggtgctggagttcgccagcgagttgaaggccgatggcgtgctgcagaaaaagctg
cgcagcctgcccaacgtgacggtcatcctgaacgcccagaccacggaagtgaatggcgat
ggcagcaaggtcaccggcctgacctacaaggaccgcacgacggacgaggccaagaccgtg
gcggtcgagggcatcttcgtgcagatcggtctgttgcccaacaccgactggctcaagggc
acggtggacctgacgcgctttggcgagatcatcatcgacgcccggggccacaccaacgtg
ccgggcgtgttcgccgcgggagactgcaccaacgtgccgtacaagcagatcatcatcgcc
gcgggggcgggcgcgacggcggccttgtcggccttcgaccacctgattcgccactga

DBGET integrated database retrieval system