KEGG   Acidovorax sp. JS42: Ajs_3236
Entry
Ajs_3236          CDS       T00455                                 

Definition
(GenBank) putative transmembrane protein
  KO
K08086  pilus assembly protein FimV
Organism
ajs  Acidovorax sp. JS42
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    Ajs_3236
SSDB
Motif
Pfam: LysM
Other DBs
NCBI-ProteinID: ABM43359
UniProt: A1WAT4
LinkDB
Position
3419322..3422078
AA seq 918 aa
MVLFTYFHAPGRLDHDQKNTAPSAPSISSFVAHMHRWKFSVLATAAILSAGLYTTDASAL
ALGRVNVQSALGEPLRAEIELPQITAAEAESLRVSTASPEVFRSQGMEYSPAAHSVQVQL
HRRTNGSMVLRLSSTRPVNDPFVDLVIDATWSSGHIVRSYTMLFDPPASRPQAAVTAAPQ
VTSPRAAATAPRAPATTAAPAPAARPATPPAPAVAGRPTPAEAPAFAGGDEIRVRPGDTA
GRIAEAHRPAGVSLDQMLVAMMRANPDAFVNSNVNRLRSGAVLQMPSETEAQATDATEAR
KIVAAQSRDFNEFRRRMAATAPKAEVAAAERSARGTVQTQVDESKPAAAGPDKLTLSKGS
VQAQKTEEQMARDKQAEQNSARMAELSKNISDLNQLSGASAPAGAGAAAPRATAPSAPAS
QPAVAVPAAGGLPAPATAAASADMSTATAEAAAPAPEASAAEAAVPAEAASQASAAAPAP
AAVAPRPAPQPVPYEEPSFLDALTEDPLLAGGALALVLALLGYGGYRVVQSRRNQGALDS
SFSESSLQPDSFFGASGGQRVDTANSELTTGSSFMTYSPSQLDAGGDVDPVAEADVYLAY
GRDLQAEEILKEALRHHPERVSIPAKLAEIYAKRQDRKALESVANDVFRLTNGQGPDWTR
VSDLGRTLDPENPLYQPGGRPAVAASATAAAASTAAFASTLGAATAPATPTGGPDSVLPD
LDLDLDLDLHEAPSAPAPAPSTFAMAAANNTAAAAPVVSAAQAPVPSLDLGDLELPQASW
DEPAVTPQATTEPDVQSEPLPLNLDDDLSLMDSGVAPLTSRDAKAVTSESLEFDLGDLSL
DLDTPTAAAPVAPSVAAKAASSAADALPDDPLATKLALAEEFNTIGDSEGARALVEEVIA
ESSGELKARAQRLLAELG
NT seq 2757 nt   +upstreamnt  +downstreamnt
atggtgctttttacatattttcacgcgcctgggcggctcgatcacgaccagaaaaatacc
gccccctcggcaccatccatctcttcattcgtcgcacacatgcatcgctggaaattttct
gtcctggccaccgcggccatcctctcggctggtctttacaccaccgatgcaagtgctctc
gccctgggccgcgtgaatgtccagtcggcgcttggcgagcccctgcgcgcggaaatcgaa
ctgccccagatcactgctgccgaggccgaatcgctgcgcgtgagcaccgccagccctgaa
gttttccgcagccagggcatggaatattcccccgctgcgcatagcgtgcaagtgcaactg
caccgccgcacgaatggctccatggtgctgcgcttgagcagtacccgcccggtcaacgat
cctttcgtggatttggttatcgatgcgacctggagttccggccatatcgtgcgtagctac
acgatgctgttcgacccgccggcgagccgcccgcaggcggcggtgaccgcagcccctcag
gtaacgtcaccccgtgccgcggcaactgcgccgcgcgcccccgccaccaccgcggcgccc
gcgcctgccgcacgcccagcaacccctcccgcacccgccgtagccggccgtcccaccccc
gcagaggcacccgcgttcgctggcggtgacgagattcgcgtgcgccccggggacacggcc
ggccgcatcgcggaagcccatcgccccgctggcgtctcgctggaccagatgctggtagca
atgatgcgcgccaatccggacgcgttcgtcaacagcaatgtgaatcgtctgcgttccggc
gcagtgctgcagatgcctagcgaaacggaggcgcaagccacggacgccaccgaagctcgc
aagatcgtcgccgcgcaaagccgcgatttcaatgaattccgtcgccgcatggcagcgaca
gcgcccaaggccgaggttgcagccgcagagcgctccgcgcgcggcactgtgcagacccag
gtggacgagagcaagcccgccgctgccggccccgataagctcactctctccaaaggcagc
gttcaggcccagaagaccgaggagcagatggcccgcgacaagcaggccgaacagaacagc
gcccgcatggcagagctgtccaagaacatctcggacctgaaccagctcagcggcgcctcc
gcgccagccggcgctggcgcagctgcgccaagagccacggcgccttccgcccctgccagc
cagccggcggtggcagtacccgccgccggggggttgcccgcacccgctaccgcggctgca
agcgccgacatgagcactgctacggcagaagctgccgcaccagcgcccgaggcctctgcc
gccgaggcggctgttcccgccgaagcagcatcccaggcttctgccgcagcacccgctccc
gccgccgtggccccgcgtccagccccccagcccgttccctacgaagagcccagcttcctg
gatgccctcacggaggacccgctgctggctggaggcgcgctggcgctcgtacttgcgttg
ctgggctatggcggctaccgcgtggtccaaagccgccgcaaccagggtgccctggacagt
tcgttctcggaaagcagcctgcagccggattctttcttcggcgccagtggcggccagcgt
gtggacacggccaacagcgaactcacgaccggctcctcgttcatgacctattcgcccagc
caactggatgccggtggcgatgtggatccggtggcggaagccgacgtctacctcgcctac
ggccgtgacctgcaggcggaggaaattctcaaggaggcgctgcgccaccatccggagcgc
gtctccatccccgccaaactggccgagatttatgccaagcgccaggaccgcaaggcgctg
gagtccgtcgccaacgacgtgttccggctcaccaacggccaggggcccgactggacccgc
gtgtccgacctgggccgtacgctcgaccctgaaaatccgctgtaccagcccggtggccgt
cctgccgttgccgccagcgccacagcggccgctgcatcgaccgcggcctttgcaagcacg
ctgggcgcagcaactgctcccgcgacacccacgggcggaccggactctgtgctgccagac
ctcgatctggacttggatctcgacctgcacgaagcaccgtcggccccggccccggcgcca
agcacgtttgccatggccgcagccaacaacaccgccgcagccgcgccggtagtgtcggcc
gcccaggcgcccgtcccgtccctggatctgggcgacctggaactaccccaggcctcctgg
gacgagccagcggtgacgccgcaggcgacgacagagcccgacgtgcaaagcgagcctctt
ccgttgaacctggacgatgacttgtccctgatggactccggcgtcgcccccctgaccagc
cgcgacgcgaaggctgtcacctcggaatccctggaattcgacctcggcgatctgtcgctg
gaccttgacacccccacggcggccgctcccgtcgcgccctcggtcgccgccaaggcagcg
tcctccgctgccgacgcgctgccggacgaccctctggccaccaagctcgcactggcggaa
gagttcaacaccattggcgacagcgaaggcgcgcgggccctggtggaagaggtcatcgcc
gaatcgtccggtgagctgaaggcccgcgcccagcgactgctcgccgaactgggctga

DBGET integrated database retrieval system