KEGG   Acidovorax sp. JS42: Ajs_3307
Entry
Ajs_3307          CDS       T00455                                 

Definition
(GenBank) carbohydrate ABC transporter ATP-binding protein, CUT1 family
  KO
K05816  sn-glycerol 3-phosphate transport system ATP-binding protein [EC:7.6.2.10]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ajs_3307
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ajs02000]
    Ajs_3307
Enzymes [BR:ajs01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.10  ABC-type glycerol 3-phosphate transporter
     Ajs_3307
Transporters [BR:ajs02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter
    Ajs_3307
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 SMC_N Rad17 AAA_16 AAA_22 RsgA_GTPase AAA_25 AAA_29 AAA Zeta_toxin AAA_28 Adeno_IVa2
Other DBs
NCBI-ProteinID: ABM43429
UniProt: A1WB04
LinkDB
Position
complement(3492691..3493731)
AA seq 346 aa
MSLIELDAVAKSWGSTTALQSMNLRIEPGSFCVLLGPSGCGKSTTLRIIAGLESPTSGSV
RIDGQDVTQLPPARRGIAMVFQNYALFPHLSVAQNIGFGLAVRKVPKAEAAQRVAHAAEL
LGLAPLLERRPAQLSGGQQQRVALGRALVAQARVCLMDEPLSNLDAQLRQEMRTELRELQ
QRLGLTVVYVTHDQAEAMSMADQVVLLHQGRVEQCAPPRDVYAAPASTFAARFIGTPAMN
LVRLEQGRIAGTDIAVGRTQAHWLGLRPEAVALDDGSGGSSGVAASVHSQEYLGADAVLR
CAIGTEFITVRAPGQHAPAANGQGVRLRWCGHDQHFFDAQGQRLAA
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtcactgatcgaacttgatgcggttgccaagtcctgggggagcaccacggcattgcag
tccatgaacctgcgcattgagcccggttctttctgcgtgctgctgggaccctcgggctgc
ggcaaatcgaccacgctgcgcatcattgcggggctggagtcacccacatcgggcagcgtg
cgcatcgacgggcaggacgtcacgcagctgccgccagcgcggcgcggcatcgcgatggtg
tttcagaactatgcgctgtttccgcatctgagcgtggcgcagaacatcggctttggactg
gcggtgcgcaaggtgcccaaggccgaggccgcgcagcgcgtggcgcatgcggccgagctg
ctcggcctggccccgctgctggagcgccggcccgcccagttgtctggcgggcagcagcag
cgcgtggcgctgggccgcgccctggtggcccaggcgcgggtatgcctgatggacgagccg
ctgtccaacctggatgcgcaattgcgccaggagatgcgcaccgagctgcgtgagctgcag
cagcgcctgggcctcaccgtggtgtacgtgacgcacgaccaggccgaggccatgagcatg
gccgaccaggtggtgctgctgcaccaggggcgtgtggagcagtgcgcgccgccgcgcgat
gtgtacgccgcgcccgcttccacctttgccgcgcgcttcatcggcacgcccgccatgaac
ctggtgcgcctggaacagggccgcatcgcgggcaccgatatcgccgtgggtcgcacgcag
gcgcactggctcggcctgcgtcccgaggccgtggccctggacgatggcagcggtgggtcg
agcggcgtggccgcctccgtgcacagccaggaatacctgggcgcggatgccgtgctgcgc
tgcgctatcggcaccgaattcatcaccgtgcgcgcgccggggcagcacgcccccgcagcc
aacggccagggtgtgcgcctgcggtggtgcgggcacgaccagcatttctttgacgcccag
ggccagcgcctggcggcttga

DBGET integrated database retrieval system