KEGG   Acidovorax sp. JS42: Ajs_3904Help
Entry
Ajs_3904          CDS       T00455                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
ajs  Acidovorax sp. JS42
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ajs03012]
    Ajs_3904
   03029 Mitochondrial biogenesis [BR:ajs03029]
    Ajs_3904
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ajs04147]
    Ajs_3904
Translation factors [BR:ajs03012]
 Eukaryotic Type
  Elongation factors
   Ajs_3904
 Prokaryotic Type
   Ajs_3904
Mitochondrial biogenesis [BR:ajs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Ajs_3904
Exosome [BR:ajs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ajs_3904
  Exosomal proteins of breast cancer cells
   Ajs_3904
  Exosomal proteins of colorectal cancer cells
   Ajs_3904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW VIT_2
Motif
Other DBs
NCBI-ProteinID: ABM44011
UniProt: A1WCN6
LinkDB All DBs
Position
complement(4150221..4151411)
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAKGYDQIDNAPEEKARG
ITINTSHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLDKYDFPGDDTPIIRGSAKLALE
GDQSDKGEPAILRLAEALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIRDTQKTTVTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPADKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaagtttgaacgtaccaagccccacgtgaacgtgggcacgatcggtcac
gtggaccatggcaagacgacgctgacggcggccatcgccaccgtgctgtccaagaagttc
ggcggcgaagccaagggctacgaccagatcgacaacgcccctgaagaaaaggcgcgcggc
atcacgatcaacacctcgcacgtggaatacgaaacggccacccgccactacgcccacgtc
gactgccccggccacgccgactacgtcaagaacatgatcaccggcgccgctcaaatggac
ggcgccatcctggtgtgctcggccgctgacggcccgatgccccagacgcgcgagcacatc
ctgctggcccgtcaggtgggcgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtcgacgacgaggaactgcttgagctggtcgaaatggaagtgcgcgagctgctggacaag
tacgacttccccggcgacgacacccccatcatccgcggctccgccaagctggccctggaa
ggtgaccagtccgacaagggcgaacccgccatcctgcgcctggccgaagccctggacacc
tacatccccacgcctgagcgcgccgtggacggcgccttcctgatgcctgtggaagacgtg
ttctccatctccggccgcggcaccgtggtgaccggccgcgtcgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggtatccgcgacacgcaaaagaccaccgtcaccggc
gtggaaatgttccgcaagctgctggaccagggccaggctggcgacaacgtgggcctgctg
ctgcgcggcaccaagcgcgaagacgtcgagcgcggccaagtgctgtgcaagcccggctcc
atcaagccccacacccacttcacggctgaggtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgcccttcttcaacaactaccgtccccagttctacttccgcaccaccgacgtg
accggctccatcgagctgccggccgacaaggaaatggtgatgcccggcgacaacgtgtcg
atcactgtgaagctgatcaaccccatcgccatggaagaaggcctgcgcttcgctatccgc
gaaggcggccgtaccgtgggcgccggcgtcgttgccaagatcattgcgtaa

DBGET integrated database retrieval system