KEGG   Acidovorax sp. JS42: Ajs_3976Help
Entry
Ajs_3976          CDS       T00455                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ajs  Acidovorax sp. JS42
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ajs_3976
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Ajs_3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABM44082
UniProt: A1WCV7
LinkDB All DBs
Position
complement(4232803..4233501)
Genome map
AA seq 232 aa AA seqDB search
MAWTHPITAKWPAAHPDRLQLYSLPTPNGVKVSILLEETGLPYEPHLVSFETNDQLSPEF
LALNPNNKIPAILDPNGPGGQPLALFESGAILVYLAEKTGRFLPQDAAARYETLQWLMWQ
MGGVGPMFGQLGFFHKFAGKDYEDKRPLGRYVAESKRLLGVLEQRLTGRDWIMGSDYTIA
DIAVFPWVRNLVGFYGAGDLVGFDAFPQVQRVLAAFVARPAVQRGLEIPARG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcatggacccaccccatcacggccaaatggccggccgcgcaccccgaccggctgcag
ctgtattcgctgcccacgcccaatggcgtgaaggtgtcgatcctgctggaagagacgggg
ctgccgtacgagccgcacctggtgagcttcgagaccaacgaccagctctcgcccgagttc
ctcgcgctcaaccccaacaacaagatccccgccatcctcgaccccaacggccccggcggc
caaccgttggcgctgttcgagtccggcgccatcctggtctacctggccgagaagaccggg
cgctttctgccgcaggacgccgccgcgcgctacgagacgctgcagtggctgatgtggcag
atgggcggggtggggccgatgtttgggcagctcgggttcttccacaagttcgcgggcaag
gactacgaggacaagcgcccgctgggccgctacgtggccgagtccaagcgcctgctgggc
gtgctggagcagcgcctgacgggccgcgactggatcatgggcagcgactacaccatcgcc
gacatcgccgtgttcccctgggtgcgcaacctggtgggcttctacggcgcgggcgatctg
gtgggctttgacgccttcccgcaggtgcagcgtgtgctggcggccttcgtggcacggccc
gccgtgcagcgggggctggagattccggcacggggctaa

DBGET integrated database retrieval system