KEGG   Acinonyx jubatus (cheetah): 106965408
Entry
106965408         CDS       T04657                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04360  Axon guidance
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106965408 (WNT5B)
   04390 Hippo signaling pathway
    106965408 (WNT5B)
   04150 mTOR signaling pathway
    106965408 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106965408 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106965408 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    106965408 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106965408 (WNT5B)
   05205 Proteoglycans in cancer
    106965408 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106965408 (WNT5B)
   05226 Gastric cancer
    106965408 (WNT5B)
   05217 Basal cell carcinoma
    106965408 (WNT5B)
   05224 Breast cancer
    106965408 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106965408 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    106965408 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106965408 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106965408 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106965408 (WNT5B)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106965408 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106965408
NCBI-ProteinID: XP_026929761
UniProt: A0A6J2AIY3
LinkDB
Position
Unknown
AA seq 358 aa
MPSLLLLAAALLSSWAQLPAEASSWWSLAVNPVQRPEVFIIGAQPVCSQLPGLSPGQRKL
CQLYQEHMAYIGEGAKTGIKECQYQFRQRRWNCSIVDNTSVFGRVMQIGSRETAFTYAVS
AAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARER
EKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKV
GDQLKEKYDSAAAMRITRKGKLELVNSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQG
RLCNKTSEGMDGCELMCCGRGYDQFKSVQVERCHCKFHWCCFVKCRKCTEIVDQYVCK
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcccagtctgctgctgctcgccgctgcactgctgtccagctgggctcagcttccggcc
gaagccagctcctggtggtcattagctgtgaacccggtgcagagacccgaggtgtttatc
atcggtgcccagcccgtgtgcagccagcttcccgggctgtcccctggccagagaaagctg
tgccaactgtaccaggagcacatggcctacataggggagggagccaagacaggcatcaag
gaatgccagtaccagttccggcagaggcgttggaactgcagcatcgtggacaacacgtct
gtctttgggagagtcatgcagatagggagccgggagacggccttcacctacgcagtgagc
gcggcaggcgtggtgaacgccatcagccgagcgtgccgcgagggtgagctctccacgtgt
ggctgcagccggacagcgcggcccaaggaccttccccgggactggctgtggggcggctgc
ggggacaatgtggaatatggctaccgctttgctaaggagttcgtggatgcccgcgagcgg
gagaagaactttgccaaggggtcggaggagcagggccgagtactcatgaacctgcagaac
aatgaggcgggtcggagggctgtgtataagatggcagacgtggcctgcaaatgccacggc
gtctcagggtcctgcagcctcaagacgtgctggctgcagctggccgagttccgcaaggtg
ggggaccagctgaaggagaagtacgacagcgcggccgccatgcgcatcacccgcaaaggc
aagctggagctggtcaacagccgcttcaaccagcccaccccggaggacctggtctacgtg
gaccccagccctgactactgcctgcgcaacgagaccacaggctccctgggcactcagggc
cgcctctgcaacaagacctcggagggcatggacggctgcgagctcatgtgctgtggccgt
ggctacgaccagttcaagagtgtccaggtggagcgctgtcactgcaagttccactggtgc
tgcttcgtcaagtgcaggaaatgcactgagatcgtcgaccagtacgtgtgcaaatag

KEGG   Acinonyx jubatus (cheetah): 106966936
Entry
106966936         CDS       T04657                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106966936 (WNT8B)
   04390 Hippo signaling pathway
    106966936 (WNT8B)
   04150 mTOR signaling pathway
    106966936 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106966936 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106966936 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106966936 (WNT8B)
   05205 Proteoglycans in cancer
    106966936 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106966936 (WNT8B)
   05226 Gastric cancer
    106966936 (WNT8B)
   05217 Basal cell carcinoma
    106966936 (WNT8B)
   05224 Breast cancer
    106966936 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106966936 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    106966936 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106966936 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106966936 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106966936 (WNT8B)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106966936 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106966936
NCBI-ProteinID: XP_026919312
UniProt: A0A6J1ZP75
LinkDB
Position
Unknown
AA seq 386 aa
MLLVKPPVFIFLFTCILRIGHTWSVNNFLMTGPKKAGRVGRKRGAWPLQGKCLPSSAERL
NFDPCVSTQAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHSGLRSANRET
AFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQ
FVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVG
AHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLL
GTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCR
RRVTKYFCSRAERPRGGAAHKPGRKP
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgttgcttgtgaagcctcctgtgttcatcttccttttcacctgtatcctccgaatcggc
cacacctggtcagtaaacaatttcctgatgactggtccaaagaaggctgggagagtgggc
aggaaaagaggtgcttggccactacagggcaaatgtctcccgagttcagctgagaggctg
aattttgacccttgtgtttctacgcaggcttacctgatatattccagcagtgtggcagct
ggtgcccagagtggtattgaagaatgcaagtatcagtttgcctgggaccggtggaactgt
cctgagagagccctgcagctgtccagccatagtggccttcgcagtgctaatcgggagaca
gcgtttgtacatgccatcagctctgctggggtcatgtacactctgactagaaactgcagc
ctcggggattttgacaactgtggctgtgatgactcccgcaatgggcagctggggggccaa
ggctggctgtggggaggctgcagtgacaacgtgggcttcggagaggcaatatccaagcag
ttcgtcgatgccctagagacaggacaggatgcccgggccgccatgaacctgcacaacaat
gaggccggccgcaaggcggtgaagggcaccatgaaacgcacgtgtaagtgccacggcgtg
tccggcagctgcaccacgcagacctgctggctgcagctgcctgagttccgcgaggtgggc
gcgcacctgaaggagaagtaccacgcggctctcaaggtggacctgctgcagggtgccggc
aacagtgcggccggccgcggcgccatcgccgacaccttccgctccatctccacgcgggag
ctggtgcacctggaggactccccggactactgcctggagaacaaaacgctaggactgctg
ggcaccgaaggccgagagtgcctgcggcgggggcgggccctgggccgctgggagcgccgc
agctgccgtcggctctgcggggactgcggactggcggtggaggagcgccgtgccgagacc
gtgtccagctgcaactgcaagttccactggtgctgcgccgtccgctgtgagcagtgccgc
cggcgggttaccaagtacttctgcagccgcgccgagcggccgcgggggggcgcggcgcac
aaacccgggagaaagccctga

KEGG   Acinonyx jubatus (cheetah): 106967018
Entry
106967018         CDS       T04657                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04360  Axon guidance
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106967018 (WNT5A)
   04390 Hippo signaling pathway
    106967018 (WNT5A)
   04150 mTOR signaling pathway
    106967018 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106967018 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106967018 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    106967018 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106967018 (WNT5A)
   05205 Proteoglycans in cancer
    106967018 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106967018 (WNT5A)
   05226 Gastric cancer
    106967018 (WNT5A)
   05217 Basal cell carcinoma
    106967018 (WNT5A)
   05224 Breast cancer
    106967018 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106967018 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    106967018 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106967018 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106967018 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106967018 (WNT5A)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106967018 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106967018
NCBI-ProteinID: XP_026894804
UniProt: A0A6J1XQS2
LinkDB
Position
Unknown
AA seq 365 aa
MAGSAMSSKFFLMALAIFFSFAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGL
SQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRET
AFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKE
FVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQ
LADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNEST
GSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVD
QFVCK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggctggaagtgcaatgtcttccaagttcttcctaatggctttggccatatttttctcc
ttcgcccaggttgtaatagaagccaattcttggtggtcgctaggtatgaataaccctgtt
cagatgtcagaagtatatatcataggagcacagcctctctgcagccaactggcaggactt
tctcaaggacagaagaaactgtgccacttgtatcaggaccacatgcagtacatcggagaa
ggcgcgaagacaggcatcaaagaatgccagtatcaattccgacatcgaaggtggaattgc
agtaccgtggataacacctctgtttttggcagggttatgcagataggcagccgcgagacg
gccttcacgtacgcggtgagcgccgcgggggtggtgaacgccatgagccgcgcgtgccgc
gagggcgagctgtccacgtgcggctgcagccgcgccgcgcgccccaaggacctgccgcgg
gactggctgtggggcggctgcggcgacaacatcgactacggctaccgcttcgccaaggag
ttcgtggacgcgcgcgagcgggagcgcatccacgccaagggctcgtacgagagcgcgcgc
atcctcatgaacttgcacaacaacgaggccggccgcaggacggtgtacaacctggctgat
gtggcctgcaagtgccacggggtgtcgggctcctgtagcctcaagacctgctggctgcag
ctggctgacttccgcaaggtgggcgacgccctgaaggagaagtacgacagcgcggccgcc
atgcggctcaacagccggggcaagctggtgcaggtcaacagccgcttcaactcgcccacc
acgcaggacctggtctacatcgaccccagccctgactactgcgtgcgcaacgagagcacg
ggctcgctgggcacgcagggccgcctgtgcaacaagacgtccgagggcatggacggctgc
gagctcatgtgctgtggccgcggctacgaccagttcaagaccgtgcagacggagcgttgc
cactgcaagttccactggtgctgctacgtcaagtgcaagaagtgcacggagatcgtggac
cagttcgtgtgcaaatag

KEGG   Acinonyx jubatus (cheetah): 106968544
Entry
106968544         CDS       T04657                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106968544 (WNT8A)
   04390 Hippo signaling pathway
    106968544 (WNT8A)
   04150 mTOR signaling pathway
    106968544 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106968544 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106968544 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106968544 (WNT8A)
   05205 Proteoglycans in cancer
    106968544 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106968544 (WNT8A)
   05226 Gastric cancer
    106968544 (WNT8A)
   05217 Basal cell carcinoma
    106968544 (WNT8A)
   05224 Breast cancer
    106968544 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106968544 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    106968544 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106968544 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106968544 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106968544 (WNT8A)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106968544 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106968544
NCBI-ProteinID: XP_014920423
UniProt: A0A6I9ZJX1
LinkDB
Position
Unknown
AA seq 343 aa
MGDLFMLRVAVGICYATFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESKNG
KPGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRAIMKRTC
KCHGISGSCSIQTCWLQLADFREMGDYLKAKYERALKIEMDKRQLRAGNSAEGHWAPTEG
FLPSAEAELIFLEESPDYCTRNSSLGIYGTEGRECLQNSHNTSRWEQRSCGRLCTECGLQ
VEERRTEAISSCNCKFQWCCTVRCDQCRHVVNKYYCTSSPGSA
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgggagacctgtttatgctcagggtggctgttggcatatgttatgccaccttcagtgcc
tctgcatggtcagtgaacaatttcctgataacaggccctaaggcctatctgacctacact
actagtgtggccctgggtgcccagagtggcattgaggagtgtaagttccaatttgcttgg
gaacgctggaactgcccggaaaatgctctccagctgtccactcacaacaggttgagaagc
gccaccagggagacttccttcattcatgcgatcagctctgctggagtcatgtacaccatc
accaagaactgtagcatgggtgactttgaaaactgtggctgtgatgagtcaaaaaacgga
aaaccaggaggtcatggctggatctggggaggctgcagcgacaatgtggaatttggggaa
aggatctccaaactctttgtggacagcctggaaaagggaaaggatgccagagccctgatg
aatcttcacaacaatagggcaggcaggctggcagtgagagccattatgaaaaggacctgc
aaatgtcatggcatctctggaagctgcagtatccagacatgctggctgcagctggctgac
ttccgggagatgggagactacctgaaggccaagtacgaacgggccctgaaaatcgagatg
gataagcggcagttaagggctgggaacagtgctgagggccactgggcacccactgaggga
ttccttcctagtgcagaggctgagctgatctttttggaggaatcaccagattactgtacc
cgcaattccagcctgggcatctatggcacagaaggtcgggagtgtctacagaatagccac
aacacatccaggtgggagcaacgcagctgtgggcgcttgtgcaccgagtgtggcctgcag
gtggaggagagaagaactgaggctatcagcagctgtaactgcaaattccagtggtgttgc
acagtcaggtgtgaccagtgtaggcatgtggtaaacaagtactactgcacaagttcccca
ggcagtgcttga

KEGG   Acinonyx jubatus (cheetah): 106969330
Entry
106969330         CDS       T04657                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106969330 (WNT1)
   04390 Hippo signaling pathway
    106969330 (WNT1)
   04150 mTOR signaling pathway
    106969330 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106969330 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106969330 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106969330 (WNT1)
   05205 Proteoglycans in cancer
    106969330 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106969330 (WNT1)
   05226 Gastric cancer
    106969330 (WNT1)
   05217 Basal cell carcinoma
    106969330 (WNT1)
   05224 Breast cancer
    106969330 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106969330 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    106969330 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106969330 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106969330 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106969330 (WNT1)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106969330 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106969330
NCBI-ProteinID: XP_026891824
UniProt: A0A6J1XH72
LinkDB
Position
Unknown
AA seq 370 aa
MGHWALLPGWVSATLWLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTATGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggcactgggcgctgctgcccggctgggtttctgctacgctgtggctggcgctggcc
gctctgcccgcagccctggccgccaacagcagtggccgatggtggggcatcgtgaacgta
gcctcctccacgaacctgctgaccgactccaagagtctacaactggtgctcgagcccagt
cttcagctgctgagccgcaaacagaggaggctgatccgccagaacccggggatcctgcac
agcgtgagcggggggctgcagagcgctgtgcgagagtgcaagtggcagttccgcaaccgc
cgctggaactgccccacggctacggggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgggaaacggcgtttattttcgctatcacctccgccggggttacccattcggtggcg
cgctcctgctcagagggctccatcgagtcttgcacgtgcgactatcggcggcgcggccct
gggggccccgattggcactgggggggctgcagcgacaacatcgacttcggccgcctcttc
ggcagggagtttgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggctggccgcacgactgtgttctctgagatgcgccaggagtgcaagtgc
cacgggatgtcgggctcgtgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgacgtgctgcgcgaccgattcgatggcgcctcgcgcgtcctgtatggcaac
cgcggcagcaaccgcgcctcgagggcggaactgctgcgcctggagcccgaggacccggcg
cacaagccgccctccccccacgacctcgtctacttcgagaaatcgcccaatttctgcacg
tacagcggacgcctgggaacggcgggcacggccgggcgcgcctgcaacagctcctcgccc
gcgctggacggctgcgagctgctctgctgtggccggggccaccgtacgcgcacacagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Acinonyx jubatus (cheetah): 106969331
Entry
106969331         CDS       T04657                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106969331 (WNT10B)
   04390 Hippo signaling pathway
    106969331 (WNT10B)
   04150 mTOR signaling pathway
    106969331 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106969331 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106969331 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106969331 (WNT10B)
   05205 Proteoglycans in cancer
    106969331 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106969331 (WNT10B)
   05226 Gastric cancer
    106969331 (WNT10B)
   05217 Basal cell carcinoma
    106969331 (WNT10B)
   05224 Breast cancer
    106969331 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106969331 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    106969331 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106969331 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106969331 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106969331 (WNT10B)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106969331 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106969331
NCBI-ProteinID: XP_026891822
UniProt: A0A6J1XHB2
LinkDB
Position
Unknown
AA seq 389 aa
MPEEPRPRPPPSGFAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSGPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPAVGSPGTRGRACNKTSRLLDGCGSLCCGRGHNLLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgccggaggagccccggccgcggcctccgccctcgggcttcgcgggtctcctgttcctg
gcgttgtgcagtcgggccctcagcaatgagattctgggcctgaagctgcccggcgagccg
ccgctgaccgccaacaccgtatgcttgacgctgtcgggcctgagcaaacggcagctaggc
ctgtgcctgcgcagccccgacgtgacggcatccgcgcttcagggcctgcatatcgcggtc
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctcggcgctggagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgggagagtgctttttcc
ttctccatgctggctgcaggggtcatgcacgcggtagccacggcctgcagcctgggcaag
ctggtgagctgcggctgcggctggaagggcagtggtgagcaggatcggctgagggccaaa
ctactgcagctgcaggcactgtcccggggcaagagtttcccccactccctgcccagtcct
ggccccggctcaggccccagccctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcaagaatgcgaatccacaacaacagggtggggcgacaggtggtgact
gaaaacctgaagcggaaatgcaagtgccatggcacgtcgggcagttgccagttcaagacc
tgctggagggcggccccagagttccgggcagtgggggcggcgttgagggagcggctgggt
cgggccatcttcatcgatacccacaaccgcaactccggagccttccagccccgcctgcgt
ccccgtcgcctctcaggagagctggtctactttgagaagtcgcctgacttctgtgagcga
gaccctgccgtgggctccccgggcactcggggccgggcctgcaataagaccagccgcctg
ctggatggctgtggcagcctgtgctgtggccgtgggcacaacctgctccggcagacacga
gtcgagcgctgtcattgccgcttccactggtgctgctacgtgctgtgtgatgagtgcaag
gtcacagagtgggtcaacgtgtgtaagtga

KEGG   Acinonyx jubatus (cheetah): 106969623
Entry
106969623         CDS       T04657                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106969623 (WNT2B)
   04390 Hippo signaling pathway
    106969623 (WNT2B)
   04150 mTOR signaling pathway
    106969623 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106969623 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106969623 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106969623 (WNT2B)
   05205 Proteoglycans in cancer
    106969623 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106969623 (WNT2B)
   05226 Gastric cancer
    106969623 (WNT2B)
   05217 Basal cell carcinoma
    106969623 (WNT2B)
   05224 Breast cancer
    106969623 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106969623 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    106969623 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106969623 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106969623 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106969623 (WNT2B)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106969623 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106969623
NCBI-ProteinID: XP_026914142
UniProt: A0A6J1Z9C8
LinkDB
Position
Unknown
AA seq 393 aa
MLKPGGAEEAAQLPPRRARAPVPALPPGPAAPDGSRASARLGLACLLLLLLLTLPARVDT
SWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNC
TTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHD
QRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECK
CHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTD
LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECK
FHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctgaagccgggtggtgcggaggaagccgcacagctcccccctcggcgcgcccgcgcc
cctgtccccgcgctcccgccaggacccgcggcccccgacggctctcgggcttcggcccgc
ctcggtcttgcctgcctgctgttgctgctgctgctgacgctgccggcccgcgtagacacg
tcctggtggtacatcggggcactgggggcccgagtgatctgtgacaatatccctggtctg
gtgagccggcagcggcagctgtgccagcgttacccagacatcatgcgctcggtgggcgag
ggtgcccgagaatggatccgagagtgtcagcaccagttccgccaccaccgctggaactgc
accacgctggaccgggaccacactgtctttggccgtgtcatgctcagaagtagccgggag
gcagcatttgtatatgccatctcgtctgcaggggtggtccatgctatcactcgtgcctgc
agccagggagaactgagtgtgtgcagctgtgacccctacacccgtggccgacaccatgac
caacgtggggattttgactggggtggctgcagtgacaacatccattatggtgttcgcttt
gccaaggcctttgtggatgccaaggaaaagaggcttaaggatgcccgggccctcatgaac
ttacataacaaccgctgtggtcgcacggctgtgcggcggtttctgaagctcgagtgtaag
tgccatggcgttagtggctcctgtactctgcgcacctgctggcgtgcactctcagacttc
cgccgcacaggggattacctgcggcggcgctacgatggggctgtgcaggtgacagcaacc
caggatggcgccaacttcacagcagcccgccaaggttatcgccgtgccacccggactgac
cttgtctactttgacaactccccagactactgtgtcttagacaaggctgcaggttcccta
ggcactgcgggccgtgtctgtagcaagacatccaaagggacggatggttgcgaaatcatg
tgctgtggccgagggtacgacacaactcgagtcacccgtgtcacccagtgtgagtgcaaa
ttccactggtgctgtgcagtgcggtgcaaggagtgcagaaacactgtggacgtccacact
tgcaaggcccccaagaaggcagagtggctggaccagacctga

KEGG   Acinonyx jubatus (cheetah): 106970053
Entry
106970053         CDS       T04657                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106970053 (WNT10A)
   04390 Hippo signaling pathway
    106970053 (WNT10A)
   04150 mTOR signaling pathway
    106970053 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106970053 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106970053 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106970053 (WNT10A)
   05205 Proteoglycans in cancer
    106970053 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106970053 (WNT10A)
   05226 Gastric cancer
    106970053 (WNT10A)
   05217 Basal cell carcinoma
    106970053 (WNT10A)
   05224 Breast cancer
    106970053 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106970053 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    106970053 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106970053 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106970053 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106970053 (WNT10A)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106970053 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 106970053
NCBI-ProteinID: XP_026906201
UniProt: A0A6J1YM53
LinkDB
Position
Unknown
AA seq 416 aa
MGSTHPCPWLRLRPRPQPRPALCALLFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTVC
LTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYESP
IFSRGFRESAFAYAIAAAGVVHAVSNACALGKLRACGCDASRRGDEEAFRRKLHRLQLDA
LQRGKGLSHGVPEHPALPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHAR
MRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRSRFHRATLIR
PHNRNGGQLEPGPAGAPSPAPGVPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGRL
CNKSSAGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgggcagcacccacccttgcccctggctgcggctccgacctcggccccagccgcggccc
gcgctctgcgcgctcctgttcttactgctgctggctgccgccgtgcccaggtctgcaccc
aacgacattctgggcctccgcctccccccggagcctgtgctcaatgccaacacggtgtgc
ctaacgttgccgggcctgagtaggcggcagatggaagtgtgtgtgcgccaccccgacgtg
gccgcctcagccatccagggcatccagatcgccatccacgagtgccagcaccagttccgg
gaccagcgctggaactgctctagtctcgagactcgaaacaagatcccctacgagagtccc
atcttcagcagaggtttccgagagagtgccttcgcctacgccatcgctgcagcgggcgta
gtgcacgcggtgtccaatgcctgcgccctgggcaaactgagggcctgcggctgcgacgcc
tctcggcgcggggacgaggaggccttccgtcggaagctgcaccgcctgcagctggacgcg
ctgcagcgcggtaagggcctgagccacggggtcccggaacacccagccctgccccctgcc
agcccgggcctgcaggactcctgggagtggggcggctgtagccccgatgtgggcttcggg
gagcgcttctccaaggactttctggactcccgggagcctcacagagacatccacgcacgc
atgaggctccacaacaaccgagttgggaggcaggcggtgatggagaacatgcggcggaag
tgcaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacgccg
gagttccgcgccgtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatccgg
ccgcacaaccgcaacggtggccagctggagcccggccccgcgggggccccctcgccagcc
ccgggcgtcccggggccgcggcgccgggccagccccgcggacctggtctacttcgagaag
tcgcccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgcctg
tgcaacaagagcagcgcgggtcccgacggctgcggtagcatgtgctgcggccgcggccac
aacatcctgcgccagacgcgcagcgagcgctgccactgccgcttccactggtgctgcttc
gtggtctgcgaggagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Acinonyx jubatus (cheetah): 106970073
Entry
106970073         CDS       T04657                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106970073 (WNT6)
   04390 Hippo signaling pathway
    106970073 (WNT6)
   04150 mTOR signaling pathway
    106970073 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106970073 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106970073 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106970073 (WNT6)
   05205 Proteoglycans in cancer
    106970073 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106970073 (WNT6)
   05226 Gastric cancer
    106970073 (WNT6)
   05217 Basal cell carcinoma
    106970073 (WNT6)
   05224 Breast cancer
    106970073 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106970073 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    106970073 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106970073 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106970073 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106970073 (WNT6)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106970073 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106970073
NCBI-ProteinID: XP_026906225
UniProt: A0A6J1YQ26
LinkDB
Position
Unknown
AA seq 365 aa
MLPPAPSLLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPPGLPGTPGPPGPAGSPDGSAAWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSALDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgcccgcgccctccctcctcgggctgctgctgttgctgctcctgtgtcccgcg
cacgtcggcggactgtggtgggcggtgggcagccccttggtcatggatcctaccagcatc
tgcaggaaagcgcggcggctggcagggcggcaggctgagttgtgccaggccgagccagag
gtggtggcagagctagcccggggcgcccggctcggggtgcgggagtgccagttccagttc
cgattccgccgctggaactgctccagccacagcaaggccttcgggcgcatcctgcagcag
gacatccgggagacggccttcgtgttcgctataacggccgcgggcgccagccacgccgtc
acgcaggcctgctccatgggcgagctgctgcagtgcggctgccaggcgccccgagggcgg
gccccgccgcgtcccccgggcctgcccggcacccctgggccccccggccccgccggctcc
cccgacggcagcgccgcctgggagtgggggggctgcggcgacgacgtggacttcggggac
gagaagtcgaggctctttatggacgcgcggcacaagcggggacgcggagacatccgtgcg
ttggtgcaactgcacaacaacgaggccggccggctggccgtacggagccacacgcgcacc
gagtgcaagtgccatgggctgtcgggctcgtgcgcgctgcgaacctgctggcagaagctg
cccccgttccgggaggtgggcgcgcggctgctcgagcgcttccacggcgcctcgcgtgtc
atgggaaccaacgacggcaaggctctgctgcccgcggtccgcactcttaagccgccgggc
cgcgccgacctgctctacgccgccgactcgcccgacttctgcgctcccaatcggcgcacc
ggctcgccgggcacgcgcggccgcgcctgcaacagcagtgccctggacctcagcggctgt
gacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgaggagaactgc
ctgtgtcgcttccactggtgctgtgtggtgcagtgccaccgctgccgcgtgcgcaaggag
ctcagcctctgcctctga

KEGG   Acinonyx jubatus (cheetah): 106970656
Entry
106970656         CDS       T04657                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106970656 (WNT16)
   04390 Hippo signaling pathway
    106970656 (WNT16)
   04150 mTOR signaling pathway
    106970656 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106970656 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106970656 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106970656 (WNT16)
   05202 Transcriptional misregulation in cancer
    106970656 (WNT16)
   05205 Proteoglycans in cancer
    106970656 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106970656 (WNT16)
   05226 Gastric cancer
    106970656 (WNT16)
   05217 Basal cell carcinoma
    106970656 (WNT16)
   05224 Breast cancer
    106970656 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106970656 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    106970656 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106970656 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106970656 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106970656 (WNT16)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106970656 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106970656
NCBI-ProteinID: XP_014922798
UniProt: A0A6I9ZIA9
LinkDB
Position
Unknown
AA seq 475 aa
MGGEAGGDGDSYTNRSFSPISARDAPAPLAHLQLRAGGGPQAPFSTSFQLLPASEGKAAE
SPYHRWPSFYVVSQGERRRGTTWFWGTDLWPGGPLGREGSSGAAGAGGLHAGAMDRAALL
GLSRLCALWAALLALFPCGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLL
PSIGEGARLGIQECRSQFRHERWNCLVTATAQPGTSPLFGYELSSGTKETAFIYAVMAAG
LVHSVTRACSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIKNT
TGKESKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLK
DKYENSIQISDKIKRKMRRREKDQRKIPIRKDDLLYLNKSPNYCVEDKKLGIPGTQGREC
NRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgggaggagaggccgggggcgatggagacagctacaccaacagaagtttctcacctatt
tcggcgagggacgctcccgcacctcttgcacacctccagctccgcgcgggaggagggccc
caagctcctttctccacctcctttcaactgctccctgcaagtgaggggaaggctgctgag
agcccctaccaccgctggccttctttttatgttgtctcacagggagagaggaggcgaggg
acaacttggttctggggaactgacctctggcctggcgggcctctgggcagagagggcagc
agtggagcggctggggctgggggactccatgctggggccatggacagagcggcgctcctg
ggactgtcccgcctgtgcgcgctgtgggcagccctgctcgcgctgttcccctgcggagcc
caaggaaattggatgtggttgggcatcgcttcctttggggttccggagaagctgggctgc
gccaacttgccgctgaacagccgccagaaggagctgtgcaagaggaaaccgtacctgctg
ccgagcatcggagagggcgcgcggctgggcattcaggagtgcaggagccagttcagacac
gagagatggaactgcctggtcaccgccaccgcccagccgggcaccagccccctctttggc
tacgagctgagcagcggcaccaaggaaacagcatttatttatgctgtgatggctgcaggc
ctggtgcattctgtgaccagggcatgcagtgcaggcaacatgaccgagtgctcctgtgac
accaccttgcagaatggcggctcagctagtgaaggctggcactgggggggctgctccgat
gatgtccagtatggcatgtggttcagcagaaagttcctagatttccccatcaaaaacacc
acaggaaaagaaagcaaagttctgttagcgatgaacctacacaacaatgaagccggaagg
caggccgtcgccaagctgatgtcagtagactgtcgctgccacggagtgtccggctcctgc
gctgtgaaaacgtgctggaaaacgatgtcttcctttgaaaagatcggccatttgttgaag
gacaaatatgaaaacagtatccaaatctcagacaaaataaagaggaaaatgcgcaggaga
gaaaaagatcagaggaagatacccatccgcaaagatgatctgctctaccttaataagtct
cccaattactgtgtagaggacaagaaactagggatcccaggaacacagggcagagaatgc
aaccgcacgtcagagggcgcggacggctgcaacctcctttgttgtggccgcggctacaac
acccacgtggtcaggcacgtggagaggtgcgagtgcaagttcatctggtgctgctacgtc
cgctgcaggaggtgtgaaagcatgactgacgtccacacttgcaagtag

KEGG   Acinonyx jubatus (cheetah): 106970665
Entry
106970665         CDS       T04657                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106970665 (WNT2)
   04390 Hippo signaling pathway
    106970665 (WNT2)
   04150 mTOR signaling pathway
    106970665 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106970665 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106970665 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106970665 (WNT2)
   05205 Proteoglycans in cancer
    106970665 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106970665 (WNT2)
   05226 Gastric cancer
    106970665 (WNT2)
   05217 Basal cell carcinoma
    106970665 (WNT2)
   05224 Breast cancer
    106970665 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106970665 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    106970665 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106970665 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106970665 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106970665 (WNT2)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106970665 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106970665
NCBI-ProteinID: XP_014922810
UniProt: A0A6I9ZIB9
LinkDB
Position
Unknown
AA seq 360 aa
MNAPLGGIWPWLPLLLTWLTPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAVSSAGVV
FAITRACSQGELKSCSCDPKKKGTAKDSKGNFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSVDWAAPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctctcggtggaatctggccctggctccccctgctcttgacctggctcacc
cctgaggtcagctcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgtgacaatgtgccaggcctggtgagccgccagcggcagctgtgccaccgacacccagat
gtgatgcgtgccattggcctaggcgtggccgagtggactgcagagtgtcagcaccagttc
cgccagcatcgctggaactgcaacaccctggacagagatcacagcctcttcggcagggtc
ctgctccgaagtagtcgggaatctgcctttgtttacgccgtctcctcagcgggagttgtg
tttgccatcaccagggcctgtagccaaggagaattaaaatcctgttcctgtgatccaaag
aagaagggaacggccaaggacagcaagggaaatttcgactggggtggctgcagtgataac
attgactatgggatcaaatttgcccgagcatttgtggatgccaaggaaaggaaaggaaag
gatgccagagccctgatgaaccttcacaacaacagagctggcaggaaggcggtaaagcgg
ttcttgaaacaagaatgcaagtgtcacggagtgagtggctcgtgtactctgaggacgtgc
tggctggccatggctgacttcagaaaaacgggcgattacctctggaggaagtacaacggg
gccatccaggtcgtcatgaaccaggatggcactggtttcactgtggctaacaagaggttt
aagaagccaacaaaaaatgaccttgtgtattttgagaattctccagactattgtatcagg
gaccgagatgcaggctctctgggtacagcaggccgtgtatgcaacctgacttcccggggc
atggacagctgcgaggtcatgtgctgcgggagaggctatgacacctcccacgtcacccgg
atgaccaagtgcgagtgtaagttccactggtgctgtgccgtgcgctgtcaggactgtctg
gaggccctggacgtgcacacatgcaaggcccctaaaagcgttgactgggcggctcccaca
tga

KEGG   Acinonyx jubatus (cheetah): 106976446
Entry
106976446         CDS       T04657                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106976446 (WNT11)
   04390 Hippo signaling pathway
    106976446 (WNT11)
   04150 mTOR signaling pathway
    106976446 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106976446 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106976446 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106976446 (WNT11)
   05205 Proteoglycans in cancer
    106976446 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106976446 (WNT11)
   05226 Gastric cancer
    106976446 (WNT11)
   05217 Basal cell carcinoma
    106976446 (WNT11)
   05224 Breast cancer
    106976446 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106976446 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    106976446 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106976446 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106976446 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106976446 (WNT11)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106976446 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106976446
NCBI-ProteinID: XP_026895653
UniProt: A0A6J1XT67
LinkDB
Position
Unknown
AA seq 354 aa
MRARPRVCEALLFALALQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTIVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELRDVASDLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSHGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcgagtctgcgaggcgctgctcttcgccctggcgctccagaccggc
gtgtgctacggcatcaaatggctggcgctgtccaagaccccggcggccctcgcgctgaac
cagacgcagcactgcaagcagctggaggggttggtatctgcgcaggtgcagctgtgccgc
agtaacctggagctcatgcacaccatcgtgcacgccgcccgcgaggtcatgaaggcctgc
cgcagggccttcgcggacatgcgctggaactgctcctccatcgagcttgcccccaactac
ctgcttgacctggagagagggacccgggagtcagccttcgtgtatgcgctgtcggcggcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcccggctgctcctgc
ggccctgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctctggaaatgaagtgtaagtgccacggggtatctggctcctgctccatc
cgcacctgctggaaggggctgcaggagcttcgggatgtggcctctgacctcaagacccgc
tacctgtcagccaccaaggtggtgcaccgacccatgggcacccgcaagcacctggtgccc
aaggacctggatatcaggcctgtgaaggactcggagcttgtctatctgcagagctcgccc
gacttctgcatgaagaacgagaaggtgggctcccatgggacgcaagacaggcagtgcaac
aagacatcccacggcagtgacagctgtgacctcatgtgctgtggacgcggctacaacccc
tacacggaccgcgtggttgagcggtgccactgcaaataccattggtgctgctacgtcacc
tgccgtaggtgtgagcgcaccgtggagcgctatgtctgcaagtga

KEGG   Acinonyx jubatus (cheetah): 106978815
Entry
106978815         CDS       T04657                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106978815 (WNT7A)
   04390 Hippo signaling pathway
    106978815 (WNT7A)
   04150 mTOR signaling pathway
    106978815 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106978815 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106978815 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106978815 (WNT7A)
   05205 Proteoglycans in cancer
    106978815 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106978815 (WNT7A)
   05226 Gastric cancer
    106978815 (WNT7A)
   05217 Basal cell carcinoma
    106978815 (WNT7A)
   05224 Breast cancer
    106978815 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106978815 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    106978815 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106978815 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106978815 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106978815 (WNT7A)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106978815 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 106978815
NCBI-ProteinID: XP_026898537
UniProt: A0A6J1Y0S8
LinkDB
Position
Unknown
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcggtggtagctctgggcgcgagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccgtcccgacgccatcatc
gtcataggagaaggctcacaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctctgcactgggagagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggctgccttcacgtacgccatcattgccgccggtgtggcccacgccatcaca
gctgcctgtacccaaggcaacctgagtgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgttctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttacacaataacgaggcgggccgaaagatcctggaggagaacatgaagctggagtgt
aagtgccacggcgtgtcgggctcctgtaccaccaagacgtgctggaccacgctgccgcag
ttccgggagctgggctacgtgctcaaggacaagtacaacgaggccgttcacgtggagccg
gtgcgcgccagccgcaacaagcggcccaccttcctgaagatcaagaagccgctgtcctac
cgcaagcccatggacaccgacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgacaggaagcgtgggcacgcagggccgcgcctgcaacaagacggccccgcag
gccagcggctgcgacctcatgtgctgcggccgcggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgcaagttccactggtgctgttacgtcaagtgcaacacctgcagc
gagcgcaccgaggtgtacacgtgcaagtga

KEGG   Acinonyx jubatus (cheetah): 106985205
Entry
106985205         CDS       T04657                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a isoform X1
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106985205 (WNT9A)
   04390 Hippo signaling pathway
    106985205 (WNT9A)
   04150 mTOR signaling pathway
    106985205 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106985205 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106985205 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106985205 (WNT9A)
   05205 Proteoglycans in cancer
    106985205 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106985205 (WNT9A)
   05226 Gastric cancer
    106985205 (WNT9A)
   05217 Basal cell carcinoma
    106985205 (WNT9A)
   05224 Breast cancer
    106985205 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106985205 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    106985205 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106985205 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106985205 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106985205 (WNT9A)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106985205 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 106985205
NCBI-ProteinID: XP_026906427
UniProt: A0A6J1YMR6
LinkDB
Position
Unknown
AA seq 365 aa
MLDGPLLARWLAAAFALTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KRLKHKYETALKVGSTTNEATGEAGAISPPRGRAAGTGGSDPLPRTPELVHLDDSPSFCL
ASRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggcccctgctggcgcgctggctggccgcggccttcgcgctgacgctgctg
ctcgccgcgctgcgcccctcggccgcctacttcgggctaacgggcagtgagcccctgacc
attctcccgctgaccctggagccggaagccgccgcccaggcacactacaaggcctgcgac
cggctgaagctggaacgcaagcaaaggcgcatgtgccgcagagacccgggggtggccgag
acactggtggaggcggtgagcatgagcgcacttgaatgccagtaccagttccggtttgag
cgctggaactgtaccttggagggccgctaccgggccagcctgctcaagcgaggcttcaag
gagaccgccttcctctacgccatctcctcggccggcctgacgcatgcgctggccaaggcg
tgcagcgcgggccgcatggagcgctgcacgtgtgatgaggcccccgacctggagaaccgg
gaggcctggcagtggggcggctgtggggacaacctcaagtacagcagcaagtttgtcaag
gagttcctgggccgccgctcaagcaaggacctgcgagcccgcgtggacttccacaacaac
ctcgtgggtgtgaaggtaatcaaggccggggtggagaccacgtgcaagtgccacggcgtg
tcgggctcctgtactgtgcggacgtgctggcggcagctggcacccttccacgaggtgggc
aagcgcctgaaacacaagtacgagacagcactcaaggtgggcagcaccaccaacgaggcc
accggggaggccggcgccatctcgccgcctcggggccgggctgcagggacaggaggcagc
gacccgctgccccgcacgccagagcttgtgcacctggacgactcgcccagtttctgcttg
gccagccgcttctccccgggcactgccggccgcaggtgccaccgggagaagaactgcgag
agcatctgctgtgggcgtggccacaacacccagagccgggtggtgacacggccctgccag
tgccaggtgcgctggtgctgctatgtggagtgcaggcagtgcactcagcgtgaggaggtc
tacacctgcaagggctga

KEGG   Acinonyx jubatus (cheetah): 106985206
Entry
106985206         CDS       T04657                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106985206 (WNT3A)
   04390 Hippo signaling pathway
    106985206 (WNT3A)
   04150 mTOR signaling pathway
    106985206 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106985206 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106985206 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106985206 (WNT3A)
   05206 MicroRNAs in cancer
    106985206 (WNT3A)
   05205 Proteoglycans in cancer
    106985206 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106985206 (WNT3A)
   05226 Gastric cancer
    106985206 (WNT3A)
   05217 Basal cell carcinoma
    106985206 (WNT3A)
   05224 Breast cancer
    106985206 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106985206 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    106985206 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106985206 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106985206 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106985206 (WNT3A)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106985206 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106985206
NCBI-ProteinID: XP_026906451
UniProt: A0A6J1YMU8
LinkDB
Position
Unknown
AA seq 352 aa
MALLVYFLFLYGLKQALGSYPIWWSLAIGPQYSSLGTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKISIQECQHQFRGRRWNCTTVNNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSATICGCSSRHQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTDRDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECSRVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccctgctcgtatacttcttattcctctacggcctgaagcaggcgctgggcagttac
ccgatctggtggtccttggccatcgggccccagtactcatccctgggcactcagcccatc
ctgtgtgccagcatcccgggcctggtgcccaagcagctgcggttctgccggaactacgtg
gagatcatgcccagcgtggcggagggcatcaagataagcattcaggagtgccagcaccag
ttccgcggccgccgctggaactgcaccaccgtcaacaacagcctggccatcttcggcccc
gtgctggacaaagccacccgggagtccgcctttgtgcatgccattgcctctgccggcgtg
gcctttgccgtgacgcgctcctgtgctgagggctccgccaccatctgtggctgcagcagc
cgccaccagggctccccgggtgagggctggaagtggggcggctgcagtgaggacatcgag
ttcggtggcatggtgtctcgggagtttgcagacgcacgggagaaccggccagatgcccgc
tctgcaatgaaccgccacaacaatgaggctggacgccaggccatcgccagccacatgcac
ctcaagtgcaaatgtcacgggctgtcgggcagctgcgaggtgaagacctgctggtggtcg
cagcccgacttccgcgccattggcgacttcctcaaagacaagtacgacagcgcctcggag
atggtggtggagaagcaccgcgagtcgcgcgggtgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggaccgcgacctagtctactacgaggcctcgcccaacttc
tgcgagcccaaccccgagaccggctcattcggtacccgcgaccgcacctgcaacgtgagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcgcacc
gagcggcgccgcgagaagtgccactgcgtcttccactggtgttgctatgtgagctgccag
gagtgctcgcgtgtctacgacgtgcacacctgcaagtag

KEGG   Acinonyx jubatus (cheetah): 106988831
Entry
106988831         CDS       T04657                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106988831 (WNT9B)
   04390 Hippo signaling pathway
    106988831 (WNT9B)
   04150 mTOR signaling pathway
    106988831 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106988831 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106988831 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106988831 (WNT9B)
   05205 Proteoglycans in cancer
    106988831 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106988831 (WNT9B)
   05226 Gastric cancer
    106988831 (WNT9B)
   05217 Basal cell carcinoma
    106988831 (WNT9B)
   05224 Breast cancer
    106988831 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106988831 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    106988831 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106988831 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106988831 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106988831 (WNT9B)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106988831 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106988831
NCBI-ProteinID: XP_026907816
UniProt: A0A6J1YRM2
LinkDB
Position
Unknown
AA seq 370 aa
MERTVVAKTGYPEGRDPPATAVAGPESRTVQAPSFALSSLTGREVLTPFPGLGTAAAPAQ
SGAHLKPCDLLKLSRRQKQLCRREPGLAETLQDAAHLSLLECQFQFRHERWNCSLEGRTG
LLKRGFKETAFLYAMSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLK
YSTKFLSNFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQ
LAPFRETGQALKLRYDSAVKVSSATNEALGRLELWAPARPGSPTKGPAPRPGDLVYMEDS
PSFCRPSKYSPGTAGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCV
QEELMYTCKH
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggagcggactgtggtagccaagactggctaccctgaggggagggacccccctgctaca
gccgtggctggccctgagtccagaacagtccaagctccctcttttgctctctctagcctg
actgggcgggaggtcctgacacccttcccagggctgggcaccgctgcggccccagcacag
agcggggcccacctgaagccgtgtgacctgctgaagctgtcccgccgacagaaacagctc
tgccggagggagcccggcctggccgagaccctgcaggacgctgctcacctcagcctgctc
gagtgccagtttcagttccgacatgagcgctggaattgcagtctggaggggaggacaggc
ctgctcaagagaggtttcaaggagacggccttcctgtatgcaatgtcctccgctgccctc
acccacactctggcccgggcctgcagcgccgggcgcatggagcgctgcacctgtgatgat
tctccgggcctggagagccggcaggcctggcagtggggcgtgtgcggcgacaacctcaag
tacagcaccaagttcctgagcaacttcctggggcccaagagaggaagcaaagacctgagg
gcacgggcggacgctcacaacacccacgtgggcatcaaggcagtgaagagtggcctcagg
accacatgtaagtgccacggtgtgtcgggctcctgtgccgtgcgcacctgctggaagcag
ctcgccccgttccgcgagacgggccaggcgctaaaactgcgttatgactcagctgtcaag
gtgtccagtgccaccaacgaggccttgggccgcctggagctgtgggcgcccgcccggcca
ggcagccccaccaagggcccggccccgcggcccggggacctggtctatatggaagactcg
cccagtttctgccggcccagcaagtactcgcccggcacggcgggcagggtgtgctcccgg
gaggccagctgcagcagcctgtgctgcgggcggggctacgacacccagagccgcctggtg
gccttctcctgccactgccaggtgcagtggtgctgctacgtggagtgccagcagtgcgtg
caggaggagctcatgtacacctgcaagcattag

KEGG   Acinonyx jubatus (cheetah): 106988834
Entry
106988834         CDS       T04657                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106988834 (WNT3)
   04390 Hippo signaling pathway
    106988834 (WNT3)
   04150 mTOR signaling pathway
    106988834 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106988834 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106988834 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106988834 (WNT3)
   05206 MicroRNAs in cancer
    106988834 (WNT3)
   05205 Proteoglycans in cancer
    106988834 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106988834 (WNT3)
   05226 Gastric cancer
    106988834 (WNT3)
   05217 Basal cell carcinoma
    106988834 (WNT3)
   05224 Breast cancer
    106988834 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106988834 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    106988834 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106988834 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106988834 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106988834 (WNT3)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   106988834 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 106988834
NCBI-ProteinID: XP_026907799
UniProt: A0A6J1YUQ4
LinkDB
Position
Unknown
AA seq 355 aa
MEPHLLGLLLGLLLCGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctctgtggcaccagggtcctc
gccggctacccaatttggtggtccctggccctgggccagcagtacacctcgctgggctcg
cagcccctgctctgcggctccatcccaggcctggtccccaagcagctgcgcttctgccgc
aattacatcgagatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagacgacagcctggccatc
ttcgggcccgtcctagacaaagccacccgcgagtcggccttcgtgcacgccatcgcctct
gccggcgtggccttcgccgtcacgcgctcctgtgccgagggcacctccaccatctgcggc
tgcgactcgcatcacaaggggccgccaggcgagggctggaagtggggcggctgcagcgag
gacgccgacttcggggtgctcgtgtcccgggagttcgcggacgcgcgcgagaacaggccg
gacgcgcgctcggccatgaacaagcacaacaacgaggcgggccgcacgaccatcctggac
cacatgcacctcaagtgcaagtgccacgggctgtcaggcagctgcgaggtcaagacctgc
tggtgggcccagcccgacttccgcgccatcggcgacttcctcaaggacaagtacgacagc
gcctccgagatggtggtggagaagcaccgcgaatcccgcggctgggtggagaccctccgc
gccaagtacgcgctcttcaagccgcccaccgagagggacctggtctactacgagaactcc
cccaacttctgcgagcccaaccccgagacgggctcctttggcaccagggaccggacttgc
aatgtcacctcccatggcatcgatggctgcgacctgctctgctgtggccgcggccacaac
acgaggacggagaagcggaaggagaaatgtcactgcatcttccactggtgctgctacgtg
agctgtcaggagtgcatccgcatctacgatgtacacacctgcaagtag

KEGG   Acinonyx jubatus (cheetah): 113599491
Entry
113599491         CDS       T04657                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04360  Axon guidance
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04919  Thyroid hormone signaling pathway
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113599491 (WNT4)
   04390 Hippo signaling pathway
    113599491 (WNT4)
   04150 mTOR signaling pathway
    113599491 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113599491 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    113599491 (WNT4)
   04916 Melanogenesis
    113599491 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    113599491 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113599491 (WNT4)
   05205 Proteoglycans in cancer
    113599491 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113599491 (WNT4)
   05226 Gastric cancer
    113599491 (WNT4)
   05217 Basal cell carcinoma
    113599491 (WNT4)
   05224 Breast cancer
    113599491 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113599491 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    113599491 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113599491 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113599491 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    113599491 (WNT4)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   113599491 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 113599491
NCBI-ProteinID: XP_026915936
UniProt: A0A6J1ZF23
LinkDB
Position
Unknown
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDVRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagtccccgctcgtgcctgcgttcgctgcgcctcctggtcttcgctgtcttctcggcc
gccgcgagcaactggctgtacctggccaagctgtcctccgtggggagcatctcggaggag
gagacgtgcgagaagctcaagggcctgatccagaggcaggtgcagatgtgcaagcggaac
cttgaggtgatggactcggtgcgccgaggtgctcagctcgccatcgaggagtgtcagtac
cagttccggaaccggcgctggaactgctccacgctcgactccctgcctgtcttcggcaag
gtggtgactcaagggacccgggaggcggccttcgtgtacgccatctcttcagcaggtgtg
gccttcgcggtgacgcgggcatgcagcagcggggagttggaaaagtgtggctgtgaccgg
acggtacatggagtcagcccgcagggcttccagtggtcgggatgctcggacaacatcgcc
tatggcgtggccttctcccagtccttcgtggacgtgcgggagagaagcaagggggcctcc
tccagccgcgccctcatgaacctccacaacaacgaggctggcaggaaggctatcctgaca
cacatgcgggtggagtgcaagtgccacggggtgtcgggctcctgtgaggtaaagacgtgc
tggcgagccgtgccgcccttccgccaggtgggccacgcactcaaagagaagttcgacggc
gccaccgaggtggagccacgccgcgtgggctcctccagggcgctggtgccacgcaacgca
cagttcaagccacacacggatgaggacctggtgtatttggagcccagcccggacttctgc
gagcaggacgtgcgcagcggcgtgctgggcacgaggggccgcacgtgcaacaagacgtcc
aaggccatcgacggctgcgagctgctgtgctgcggccggggcttccacacggcccaggtg
gagctggccgagcgctgcagctgcaaattccactggtgctgcttcgtcaagtgccggcag
tgccagcggctggtggagctgcacacgtgccggtga

KEGG   Acinonyx jubatus (cheetah): 113602684
Entry
113602684         CDS       T04657                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113602684 (WNT7B)
   04390 Hippo signaling pathway
    113602684 (WNT7B)
   04150 mTOR signaling pathway
    113602684 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113602684 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    113602684 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113602684 (WNT7B)
   05205 Proteoglycans in cancer
    113602684 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113602684 (WNT7B)
   05226 Gastric cancer
    113602684 (WNT7B)
   05217 Basal cell carcinoma
    113602684 (WNT7B)
   05224 Breast cancer
    113602684 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113602684 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    113602684 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113602684 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113602684 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    113602684 (WNT7B)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Morphogens
   113602684 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 113602684
NCBI-ProteinID: XP_026926254
UniProt: A0A6J2ACL1
LinkDB
Position
Unknown
AA seq 356 aa
MAQPPSLDHAQKLSQVDFLRVSLLWRPLREARSAVVRRGPGSQHHLQQDSWLGPTAACHL
PEPARCHHRDRGGGADGHQRVPVPIPLRTLELLRPGREDCLRARAPRSREAAFTYAITAA
GVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIK
KNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYN
AAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRL
CNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcgcagcccccctccctggatcatgcacagaaactttcgcaagtggattttctacgt
gtttctctgctttggcgtcctctacgtgaagctcggagcgctgtcgtccgtcgtggccct
gggagccaacatcatctgcaacaagattcctggcttggccccacggcagcgtgccatctg
ccagagccggcccgatgccatcatcgtgatcggggagggggcgcagatgggcatcaacga
gtgccagtaccaattccgcttcggacgctggaactgctccgccctgggcgagaagactgt
cttcgggcaagagctccgaggagccgggaggccgccttcacctacgccatcaccgcggcc
ggggtggcccacgcggtcacggccgcctgcagccaggggaacctgagcaactgcgggtgc
gaccgagagaagcagggctactacaaccaggcggagggctggaagtggggcggctgctcc
gccgacgtgcgctacggcatcgacttctcccggcgcttcgtggacgcccgtgagatcaag
aaaaacgcgcggcgcctcatgaacctgcacaacaacgaggccggcaggaaggtcctggag
gagcgcatgaagctggagtgcaagtgccacggcgtgtcgggctcgtgcaccaccaagacg
tgctggaccacgctgcccaagttccgcgaggtgggccacctgctcaaggagaagtacaac
gccgcggtgcaggtggaggtggtgcgggccagccgcctgcggcagcccaccttcctgcgt
atcaagcagctgcgcagctaccagaagcccatggagactgacctggtgtacatcgagaag
tcgcccaactactgcgaggaggacgcggccacgggcagcgtgggcactcagggccgcctg
tgcaaccgcacgtcgccgggcgcggacggctgcgacaccatgtgctgcggccgtggctac
aacacccaccagtacaccaaggtgtggcagtgcaactgcaagttccactggtgctgcttt
gtcaagtgcaacacctgcagcgagcgcaccgaggtcttcacctgcaagtga

DBGET integrated database retrieval system