KEGG   Acinonyx jubatus (cheetah): 106965433Help
Entry
106965433         CDS       T04657                                 

Gene name
CLEC6A
Definition
(RefSeq) C-type lectin domain family 6 member A
  KO
K17514  C-type lectin domain family 6 member A
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:aju00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106965433 (CLEC6A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:aju04054]
    106965433 (CLEC6A)
   04091 Lectins [BR:aju04091]
    106965433 (CLEC6A)
Pattern recognition receptors [BR:aju04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   106965433 (CLEC6A)
Lectins [BR:aju04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    106965433 (CLEC6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WRW
Motif
Other DBs
NCBI-GeneID: 106965433
NCBI-ProteinID: XP_026929993
LinkDB All DBs
Position
Unknown
AA seq 134 aa AA seqDB search
MMVREGQPQDREKAVWRSQVRFWSVAVSSIALLSACFIVSCVVTYHLTYGKTGQRLSELH
TRHSGLTCFSEGTSMRGNVWACCPCAWKSFGSSCYFISTEQNFWSKSEQNCVAMGAHLVV
INTEAEQVLVFIFH
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgagaagggcaacctcaagatagagagaaagcagtatggcggtcccaagta
agattctggtctgttgctgtgagttccatagcactcctcagtgcttgtttcattgtgagc
tgtgtggtgacttatcatcttacatatggcaaaactggccaaaggctgtctgaactacac
acacgccactcaggtttaacctgcttcagtgaagggacaagcatgagagggaatgtctgg
gcatgttgcccatgtgcttggaagtcatttggttccagctgctacttcatttctactgag
cagaatttttggtcaaagagtgaacagaactgtgttgcaatgggtgctcacttggtggtg
atcaacacagaagcagagcaggtacttgtgtttatttttcattaa

DBGET integrated database retrieval system