KEGG   Acinonyx jubatus (cheetah): 106965473
Entry
106965473         CDS       T04657                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04020  Calcium signaling pathway
aju04022  cGMP-PKG signaling pathway
aju04024  cAMP signaling pathway
aju04260  Cardiac muscle contraction
aju04261  Adrenergic signaling in cardiomyocytes
aju04270  Vascular smooth muscle contraction
aju04713  Circadian entrainment
aju04720  Long-term potentiation
aju04723  Retrograde endocannabinoid signaling
aju04724  Glutamatergic synapse
aju04725  Cholinergic synapse
aju04726  Serotonergic synapse
aju04727  GABAergic synapse
aju04728  Dopaminergic synapse
aju04742  Taste transduction
aju04911  Insulin secretion
aju04912  GnRH signaling pathway
aju04921  Oxytocin signaling pathway
aju04924  Renin secretion
aju04925  Aldosterone synthesis and secretion
aju04927  Cortisol synthesis and secretion
aju04929  GnRH secretion
aju04930  Type II diabetes mellitus
aju04934  Cushing syndrome
aju04935  Growth hormone synthesis, secretion and action
aju05010  Alzheimer disease
aju05020  Prion disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05031  Amphetamine addiction
aju05410  Hypertrophic cardiomyopathy
aju05412  Arrhythmogenic right ventricular cardiomyopathy
aju05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106965473 (CACNA1C)
   04020 Calcium signaling pathway
    106965473 (CACNA1C)
   04024 cAMP signaling pathway
    106965473 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    106965473 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    106965473 (CACNA1C)
   04929 GnRH secretion
    106965473 (CACNA1C)
   04912 GnRH signaling pathway
    106965473 (CACNA1C)
   04921 Oxytocin signaling pathway
    106965473 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    106965473 (CACNA1C)
   04924 Renin secretion
    106965473 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    106965473 (CACNA1C)
   04927 Cortisol synthesis and secretion
    106965473 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106965473 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    106965473 (CACNA1C)
   04270 Vascular smooth muscle contraction
    106965473 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    106965473 (CACNA1C)
   04727 GABAergic synapse
    106965473 (CACNA1C)
   04725 Cholinergic synapse
    106965473 (CACNA1C)
   04728 Dopaminergic synapse
    106965473 (CACNA1C)
   04726 Serotonergic synapse
    106965473 (CACNA1C)
   04720 Long-term potentiation
    106965473 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    106965473 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    106965473 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    106965473 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106965473 (CACNA1C)
   05020 Prion disease
    106965473 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    106965473 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    106965473 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    106965473 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106965473 (CACNA1C)
   05414 Dilated cardiomyopathy
    106965473 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    106965473 (CACNA1C)
   04934 Cushing syndrome
    106965473 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aju04040]
    106965473 (CACNA1C)
Ion channels [BR:aju04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106965473 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 106965473
NCBI-ProteinID: XP_026929708
UniProt: A0A6J2AJZ2
LinkDB
Position
Unknown
AA seq 2252 aa
MLRAFVQPAAPAYQPLPRHPSAESEVKFKGTLVHEAQLNCFYIPPGGSNYGSPRAAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTISSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNRSTPAGLLDQKKGKFAWFSHSTETHVSMPTSETESVNTENVAGGDIE
GENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEH
YNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETIL
VETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIF
SLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFP
GMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPE
KKQEIMEKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNPENTGE
DDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNL
ILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYVFTSIFT
LEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRP
LRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQT
EAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSI
DSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKN
QRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSC
LFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNH
YFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLV
KLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNN
NFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFI
SFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDV
VTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN
LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQ
GLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFR
RAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGNSQGDTESPSHEKLVDSTFTPSS
YSSTGSNANINNANNTALGRFPRPAGYPSAVSTVEGHGPPLSPAVRVQEAAWKLSSKRIH
CYDVLGRCHSRESQIAMVCQEEVSQDETYDVKISEDTEYCSEPSLISTEMLSYQDDENRQ
LTPPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQ
ALAVAGLSPLLQRSHSPSTSPRPCATPPATPGSRGWPPQPIPTLRLEGAESNEKLNSSFP
SIHCSSWSGEPTPCGGGGSTIRRARPVSLTVPGQAGAQGRQFHGSASSLVEAVLISEGLG
QFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDR
AEGQEGETCAPTLACRKSEEELQDSRAHVGSL
NT seq 6759 nt   +upstreamnt  +downstreamnt
atgcttcgagcctttgttcagcctgctgcgcctgcataccagccgcttcccaggcaccct
tctgccgagtcagaggtgaagtttaagggcactttggtgcatgaagctcaactcaactgt
ttctacatccctcctggaggttccaactatgggagcccgcgtgcagctcacgccaacatg
aatgccaatgcagctgcggggcttgcccccgagcacatcccaacgcccggggcagccttg
tcctggcaggcagccatcgacgcggcccggcaggctaagctgatgggcagcgctggcaat
gcaaccatctccaccatcagctccacacagcggaagcggcagcaatatgggaaacccaag
aagcagggcagcacgactgccacacgcccgccccgtgccctgctctgcctgactctgaag
aaccccatcaggagggcgtgcatcagcatcgtcgaatggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaagat
gactccaatgccaccaattccaacctggaacgagtggaatatctctttctcataattttt
actgtggaagcatttttaaaagtaatagcctatggacttctctttcaccccaacgcttac
ctccgcaatggctggaatttactagattttataattgtggttgtagggctttttagtgca
attttagaacaagccaccaaagctgacggggcaaatgctctaggagggaaaggagctgga
tttgatgtgaaggcactgagggcattccgcgtgctgcgccccttgcggctggtgtctgga
gtcccaagtctccaagtcgttctgaattccattatcaaggccatggtccccctgctgcat
attgccctgttagtgctatttgtcatcatcatctacgctatcattggcctggagctcttc
atgggaaagatgcataagacctgctacaaccaggagggcatagcagatgttccagcagaa
gatgatccttccccttgtgctctggagactggccatgggcggcagtgccagaatggcact
gtgtgcaagcctggctgggacgggcccaagcacggcatcaccaactttgacaattttgcc
ttcgccatgttgacagtgttccagtgcatcaccatggagggctggacagatgtgctatac
tggatgcaggacgctatgggctatgagttaccctgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgtgttgagcggagagttttccaaa
gagagagagaaggccaaggctcggggagacttccagaagctgcgagagaagcagcagctg
gaagaggacctgaagggctacctggactggatcacccaggcagaggacatcgaccctgag
aacgaggatgaaggcatggatgaggagaagccccgaaacagaagcactccagcgggcttg
cttgatcagaagaaagggaagtttgcttggtttagtcactccacagaaacccatgtgagc
atgcccacaagtgagaccgagtctgtcaacaccgaaaacgtggctggaggtgacatcgag
ggagagaactgcggggccaggctggcccatcggatttccaaatcaaagttcagccgctac
tggcgtcggtggaatcggttctgcagaagaaagtgtcgtgctgcagtcaagtctaatgtc
ttctactggcttgtgatcttcctggtgttcctcaacacactcaccatcgcctcagaacat
tacaaccagccccactggctcacggaggtccaagacacggccaacaaggcactactggcc
cttttcactgcggagatgctgctaaagatgtacagcctgggcctgcaggcctactttgtg
tccctcttcaaccgctttgactgcttcatcgtgtgtgggggcattctggagaccatcctg
gtggagaccaagatcatgtctcccttgggcatctctgtgctgagatgtgtccggctactg
cggatatttaaaatcacaaggtactggaactccttaagcaacctggtggcatccttgctg
aattctgtgcgctccattgcctccctgctgctactcctcttcctcttcatcatcatcttc
tccctcctggggatgcagctctttggaggaaagttcaactttgatgagatgcagactcgg
aggagcacatttgataactttcctcagtccctcctcaccgtgtttcagatcctgaccggg
gaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccctcttttcca
gggatgttagtctgtatttacttcatcatcctcttcatctgtggaaactatatcctactg
aatgtgttcttggccattgctgtggacaatctggctgatgctgagagcctcacatctgcc
caaaaggaggaggaagaagagaaggagagaaagaagctggccaggactgccagcccagag
aagaagcaagagataatggaaaagccagctgtggaggaaaccaaggaggagaaaattgag
ctgaaatccattacagctgatggagagtccccacccaccaccaagatcaacatggatgac
ctccagcccaatgaaaatgaagataagagtccctaccccaacccagaaaatacaggagaa
gacgatgaagaggagcctgagatgcctgtgggcccccgcccacgaccactctctgagctg
caccttaaggaaaaggcagtgcccatgccagaagccagtgcatttttcatcttcagcccc
aacaacagatttcgcctccagtgccaccgcattgtcaatgacacgatcttcaccaacctg
atcctcttcttcattctgctcagcagcatttccctggcagctgaggaccctgtccagcac
acctccttcaggaaccatattctgttttattttgacattgttttcactaccattttcacc
attgaaattgctctgaagatcctaggcaatgcagactatgtcttcactagtatctttaca
ttagaaattatccttaagatgactgcttatggggctttcctacacaagggctctttctgc
cggaactacttcaacatcttggacctgctggtggtcagcgtgtccctcatctcctttggc
atccagtccagtgcaattaatgtggtgaagatcttgcgagttctgcgagtcctcaggccc
ctgagggccatcaacagggccaaggggctaaagcacgtggtccagtgcgtgtttgttgcc
atccggaccatagggaatatcgtgattgtcaccacgctgctccagttcatgttcgcctgc
atcggggtccagcttttcaagggaaagctctacacctgttcagatagttccaagcagacc
gaggcggaatgcaagggtaactacatcacatacaaggatggggaagttgaccaccccatc
atccagcctcgcagctgggaaaacagcaagtttgactttgacaatgttctggcagccatg
atggccctctttaccgtctccacctttgaggggtggccagagctgctgtaccgctccatc
gactcccacacagaagacaagggccccatctacaactaccgtgtggagatctccatcttt
ttcatcatctacatcatcatcattgccttcttcatgatgaacatcttcgtgggttttgtc
atcgtcaccttccaggagcagggggagcaggaatacaagaactgtgaactggacaagaac
cagcgacagtgtgtggaatatgccctcaaggcccggcccttgcggaggtacatccccaaa
aaccagcaccagtacaaagtgtggtacgtggtcaactccacctactttgaatacctgatg
ttcgtcctcatcctactcaacaccatctgcttggcaatgcagcactatggccagagctgc
ctattcaaaatcgccatgaacatcctcaacatgctcttcactggcctcttcactgtggag
atgattctgaagctcattgccttcaaacccaagggttactttagtgatccctggaatgtt
tttgacttcctcatcgtaattggcagcataattgacgtcattctcagtgaaactaatcac
tatttctgtgatgcatggaatacatttgacgccttgattgttgtgggtagcattgttgat
atagcaatcaccgaggtaaacccagctgaacatacccaatgctctccctttatgaacgca
gaggagaactcccgcatctccatcaccttcttccgcctcttccgggtcatgcgcctggtc
aagctgctaagccgtggggagggcatccggaccctgctgtggaccttcatcaagtccttc
caggctttgccctatgtggcccttctgatagtgatgctgttcttcatctacgcagtgatc
gggatgcaggtgtttgggaaaattgccctgaatgacaccacagaaatcaaccggaacaac
aactttcagaccttcccccaagctgtgctccttctcttcaggtgtgccacaggggaggca
tggcaagacatcatgctggcctgcatgccagggaagaagtgtgcccccgagtcagagccc
agcaacagcacggaaggggaaacgccctgtggcagcagttttgccgtcttctacttcatc
agcttctacatgctctgtgccttcctgatcatcaacctctttgtagctgtcatcatggac
aactttgactacctgacaagagactggtcaatccttggtccccatcatctggatgaattt
aaaagaatctgggcagagtatgatcctgaagctaagggtcgtatcaaacacctagatgtg
gtgaccctgctccggcggattcagcccccactgggttttgggaagctgtgccctcaccgc
gtggcttgcaaacgcctggtctccatgaacatgcctctgaacagtgatgggactgtcatg
ttcaatgccaccctgtttgccctagtccggacagccctgcggatcaaaacagaagggaac
ctagaacaagccaatgaggagctgcgggccataatcaagaagatctggaagcgtaccagc
atgaagctgctagaccaagtggtgccccctgcaggtgatgatgaggtcaccgttggcaag
ttttatgctactttcctgatccaagagtacttccggaaattcaagaagcgcaaagagcag
ggccttgtgggcaagccttcccaaaggaacgccctgtccttgcaggctggcttgcgcacg
ctgcatgacattgggcctgagatccgacgggccatctctggagatctgacagctgaggag
gagctggacaaggccatgaaggaggctgtgtctgctgcctccgaagatgacatcttcagg
agggccggtggcctgttcggcaaccacgtcagctactaccaaagcgacggccggagcgcc
ttcccccagaccttcaccacccagcgcccactgcacatcaacaaggcgggtaacagccaa
ggcgacaccgagtcgccatcccacgagaaactggtggactccaccttcacccccagcagc
tactcgtccactggctccaacgccaacatcaacaatgccaacaacactgccctgggccgc
ttcccccgtcccgctggctaccccagcgcagtcagcaccgtggagggccatgggcccccc
ttgtctcctgctgtccgggtacaggaggcagcatggaagctcagctccaagaggatacat
tgctatgatgtgctgggacggtgccactcccgggagagccagatagccatggtgtgtcag
gaggaggtctctcaggacgagacctatgatgtgaagataagtgaagacactgagtactgc
agcgagcccagcctgatctccacagagatgctgtcctatcaggatgatgaaaatcggcaa
ttaacaccaccggaggaggacaagagagatatccggcaatctccaaagaggggcttcctc
cgctctgcctcactaggtcgaagggcctccttccacctggaatgtctgaagcgacagaag
aatcaagggggagacatctctcagaagacagtcctgcccttgcatctggttcatcatcag
gcattggcggtggcaggcctgagccccctcctccagagaagccattcccccagcacatcc
cccaggccctgtgccaccccaccagccactccaggcagccgaggctggcccccacagcct
atccccaccctgcggctggagggtgccgaatccaacgagaaactcaacagcagcttcccg
tccatccactgcagctcctggtctggggagcccacaccctgtggcggaggtggcagcacc
atccggagagcccggccagtgtccctcactgtgcccggccaggctggggcccagggcagg
cagttccacggcagtgccagcagcctggtagaagcggtcttgatttcagaaggactgggg
cagtttgctcaagatcccaagtttattgaggtcacaacccaggagctggctgacgcctgt
gacatgaccatagaggagatggagaacgccgcagacaacatcctcagtgggggcgcccag
cagagccccaatggcaccctactacctttcgttaactgcagggacccagggcaggacaga
gcagagggccaagagggcgagacctgcgcgcccaccctggcgtgtcggaagagcgaggag
gagctccaggacagcagagcccacgtcggcagcctgtag

DBGET integrated database retrieval system