KEGG   Acinonyx jubatus (cheetah): 106965649
Entry
106965649         CDS       T04657                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01522  Endocrine resistance
aju04012  ErbB signaling pathway
aju04066  HIF-1 signaling pathway
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04151  PI3K-Akt signaling pathway
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju04934  Cushing syndrome
aju05162  Measles
aju05165  Human papillomavirus infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05203  Viral carcinogenesis
aju05206  MicroRNAs in cancer
aju05215  Prostate cancer
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106965649 (CDKN1B)
   04066 HIF-1 signaling pathway
    106965649 (CDKN1B)
   04068 FoxO signaling pathway
    106965649 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    106965649 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106965649 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106965649 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    106965649 (CDKN1B)
   05206 MicroRNAs in cancer
    106965649 (CDKN1B)
   05203 Viral carcinogenesis
    106965649 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    106965649 (CDKN1B)
   05220 Chronic myeloid leukemia
    106965649 (CDKN1B)
   05215 Prostate cancer
    106965649 (CDKN1B)
   05222 Small cell lung cancer
    106965649 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106965649 (CDKN1B)
   04934 Cushing syndrome
    106965649 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    106965649 (CDKN1B)
   05169 Epstein-Barr virus infection
    106965649 (CDKN1B)
   05165 Human papillomavirus infection
    106965649 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    106965649 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106965649
NCBI-ProteinID: XP_026891400
UniProt: A0A6J1XFY7
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRQAVPLIG
SQANTEDTHLVDQKTDTSDNQTGLAEQCPGIRKRPATDDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctccgcctgcaggaacctcttcggcccggtcaaccacgaagag
ttgacccgggacttggagaagcactgcagagacatggaagaggcaagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaagaggtggaa
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgccaggcggtgcctttaattggg
tctcaggcaaacacagaggacacacatttggtagaccaaaagactgatacatcggacaac
cagacggggttagcggagcagtgccctgggataaggaagcgacctgctacagatgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtctcagacggttccccgaac
gcgggttcagtggagcagacgcccaagaagcctggcctgagaagacgtcaaacgtaa

DBGET integrated database retrieval system