KEGG   Acinonyx jubatus (cheetah): 106965977Help
Entry
106965977         CDS       T04657                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04068  FoxO signaling pathway
aju04146  Peroxisome
aju04211  Longevity regulating pathway
aju04213  Longevity regulating pathway - multiple species
aju05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106965977 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106965977 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    106965977 (SOD2)
   04213 Longevity regulating pathway - multiple species
    106965977 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    106965977 (SOD2)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106965977 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 106965977
NCBI-ProteinID: XP_014917541
LinkDB All DBs
Position
Un
AA seq 287 aa AA seqDB search
MSAVLGARQASSGKPQLLLRGGRRTAGRPRRAGSSEEAGKHRPHQPRPSPRTSEGAGLQT
RERIGVCVCSLSSSSRTLVPALGALGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHH
ATYVNNLNVLEERYREALEKGDVTTQVALQPGLKFNGGGHINHSIFWTNLSPKGGGEPKG
ELLEAIKRDFGSFDKFKEKLTTVSVGVQGSGWGWLGFNKEQGRLQIAACFNQDPLEGTTG
LIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcggtgctgggggcgcgccaagccagctcagggaaaccgcagcttttgctccga
ggaggtcgccggaccgcaggccgaccccggcgtgcgggcagcagcgaagaggcggggaag
caccggccccaccagccaaggccctccccgcggacctccgagggggcggggcttcagaca
cgtgagcgaatcggtgtgtgtgtctgctctctttccagctcgagcaggacgctggtgccg
gcgctgggggctctgggttccaggcagaagcacagcctccccgacttgccgtacgattat
ggcgccctggagcctcacatcaacgcccagatcatgcagctgcaccacagcaagcaccac
gcgacctacgtgaacaacctgaacgtcctcgaggagcggtatcgagaggcgctggagaag
ggtgacgttacaactcaggtagctcttcagcctgggctgaagttcaatggtggaggccat
atcaatcattccatcttctggacgaacctgagccctaagggtggtggagagcccaaaggg
gaattgctggaagccatcaaacgtgattttggttccttcgacaaatttaaagagaagttg
accactgtatctgttggcgtccaaggctcaggttggggttggcttggtttcaataaggaa
cagggacgcttgcagattgctgcttgttttaaccaggatcccctggaaggaacaacaggt
cttattccactgctggggattgatgtgtgggagcatgcttattaccttcagtataaaaat
gtcagaccggattatctaaaagctatttggaatgtaatcaactgggagaacgtaactgag
agatacatggcttgcaaaaagtaa

DBGET integrated database retrieval system