KEGG   Acinonyx jubatus (cheetah): 106966348
Entry
106966348         CDS       T04657                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X3
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01522  Endocrine resistance
aju01524  Platinum drug resistance
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04115  p53 signaling pathway
aju04120  Ubiquitin mediated proteolysis
aju04144  Endocytosis
aju04151  PI3K-Akt signaling pathway
aju04218  Cellular senescence
aju04625  C-type lectin receptor signaling pathway
aju04919  Thyroid hormone signaling pathway
aju05163  Human cytomegalovirus infection
aju05165  Human papillomavirus infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05203  Viral carcinogenesis
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05218  Melanoma
aju05219  Bladder cancer
aju05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106966348 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106966348 (MDM2)
   04151 PI3K-Akt signaling pathway
    106966348 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106966348 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    106966348 (MDM2)
   04115 p53 signaling pathway
    106966348 (MDM2)
   04218 Cellular senescence
    106966348 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106966348 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    106966348 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106966348 (MDM2)
   05202 Transcriptional misregulation in cancer
    106966348 (MDM2)
   05206 MicroRNAs in cancer
    106966348 (MDM2)
   05205 Proteoglycans in cancer
    106966348 (MDM2)
   05203 Viral carcinogenesis
    106966348 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    106966348 (MDM2)
   05220 Chronic myeloid leukemia
    106966348 (MDM2)
   05218 Melanoma
    106966348 (MDM2)
   05219 Bladder cancer
    106966348 (MDM2)
   05215 Prostate cancer
    106966348 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    106966348 (MDM2)
   05169 Epstein-Barr virus infection
    106966348 (MDM2)
   05165 Human papillomavirus infection
    106966348 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106966348 (MDM2)
   01522 Endocrine resistance
    106966348 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aju04131]
    106966348 (MDM2)
   04121 Ubiquitin system [BR:aju04121]
    106966348 (MDM2)
Enzymes [BR:aju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106966348 (MDM2)
Membrane trafficking [BR:aju04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106966348 (MDM2)
Ubiquitin system [BR:aju04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106966348 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP zf-RING_2 SWIB zf-FPG_IleRS Tyrosinase
Other DBs
NCBI-GeneID: 106966348
NCBI-ProteinID: XP_014917943
UniProt: A0A6I9ZGN3
LinkDB
Position
Unknown
AA seq 430 aa
MTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQHEPSDSGTS
VSENRCHLEGGSDQKDPVQELQEEKPSSSDLVSRPSTSSRRRTISETEEHSDELPGERQR
KRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSV
SDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLAD
YWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKDKGKMPEKAKVENSTQVEEGFDVPD
CKKTTVNDSRESCAEENDDKITQASQSQESEDYSQPSTSNSIIHSSQEDVKEFEREETQD
KEEIMESSFPHNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQP
IQMIVLTYFP
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgactaaacgattatatgatgagaagcaacagcatattgtgtattgttccaatgatctc
ctaggggatttgtttggagtgccaagcttctctgtgaaagaacacaggaaaatatataca
atgatctacagaaacttggtagtagtcaatcagcatgaaccatcagattcaggcacatct
gtgagtgaaaataggtgtcaccttgaaggtgggagtgatcaaaaggaccctgtgcaagag
ttgcaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatctaga
aggagaacaattagtgagacagaagaacattcagatgaattacctggtgaacggcagaga
aagcgccacaagtctgatagtatttctctttcctttgatgaaagccttgctctgtgtgta
ataagggagatatgttgtgaaagaagcagtagcagcgaatcaacggggactccgtcaaat
ccggatctcgatgctggtgtaagtgaacattcaggtgattggttggatcaggattcagtt
tcagatcaattcagtgtagaatttgaagttgagtctctcgattcagaagattatagcctt
agtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagtaactgtgtat
caggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagctgac
tattggaagtgtacttcgtgcaatgaaatgaatcctcctcttccacctcattgcaacaga
tgttgggctcttcgtgagaattggcttcctgaagataaagggaaagataaagggaaaatg
cctgagaaagccaaagtggaaaactcaacacaagtagaagagggctttgatgtccctgat
tgtaaaaaaactacagtgaatgattccagggaatcatgtgctgaggaaaatgatgataaa
atcacacaggcctcccaatcccaagaaagtgaggactattctcagccatcaacttctaac
agcatcattcatagcagccaagaagatgtcaaagagtttgagagggaagaaacacaagac
aaagaagaaatcatggagtctagttttccccataatgccattgaaccttgtgtgatttgc
cagggtcgacctaaaaatggttgcattgttcatggcaaaacaggacatcttatggcatgc
tttacttgtgcaaaaaagctaaagaagaggaataagccctgtccagtatgtagacaacca
attcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system