KEGG   Acinonyx jubatus (cheetah): 106966653Help
Entry
106966653         CDS       T04657                                 

Gene name
WDR48
Definition
(RefSeq) WD repeat-containing protein 48 isoform X2
  KO
K15361  WD repeat-containing protein 48
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    106966653 (WDR48)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aju03400]
    106966653 (WDR48)
DNA repair and recombination proteins [BR:aju03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     106966653 (WDR48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3337 WD40 ANAPC4_WD40 Nucleoporin_N WD40_like RAWUL
Motif
Other DBs
NCBI-GeneID: 106966653
NCBI-ProteinID: XP_014918263
LinkDB All DBs
Position
Unknown
AA seq 677 aa AA seqDB search
MAAHHRQNTAGRRKVQVSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGRDSIIRIWSVN
QHKQDPYIASMEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYV
KALAYAKDKELVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQLG
TIIVSGSTEKVLRVWDPRTCAKLMKLKGHTDNVKALLLNRDGTQCLSGSSDGTIRLWSLG
QQRCIATYRVHDEGVWALQVNDAFTHVYSGGRDRKIYCTDLRNPDIRVLICEEKAPVLKM
ELDRSADPPPAIWVATTKSTVNKWTLKGIHNFRASGDYDNDCTNPITPLCTQPDQVIKGG
ASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWF
SVDLKTGMLTITLDESDCFAAWVSAKDAGFSSPDGSDPKLNLGGLLLQALLEYWPRTHVN
PMDEEENEVNHVNGEQENRVQKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESM
LLNETVPQWVIDITVDKNMPKFNKIPFYLQPHASSGAKTLKKDRLSASDMLQVRKVMEHV
YEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHF
IWKSGGDLTLHYRQKST
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccatcaccggcagaacacggcagggcggaggaaagtgcaggtttcctatgtt
attcgagatgaagtagagaagtacaatcgaaatggagtcaatgccctgcagctggatcca
gcactgaacagacttttcacggccggtcgagactccatcataagaatatggagtgtcaat
cagcacaagcaagatccatatatagcatctatggaacaccataccgattgggtaaacgac
attgtgctttgttgtaatgggaaaacattaatatctgcttcttctgacacaacagtgaaa
gtgtggaatgcacataagggattttgcatgtcaacactaaggacacataaggattatgta
aaggccttagcctatgccaaggataaagaactggtagcttcagctgggttggacagacag
atattcctttgggatgtgaataccttaacagcattgactgcctcaaacaacactgtcaca
acctcttctttaagcgggaacaaagattccatttatagcctggcaatgaatcaactggga
acaatcattgtatcagggtccactgagaaggttttaagggtgtgggatccaagaacatgt
gcgaaactaatgaagctgaaagggcacacagacaatgtcaaagcactgctgttgaacagg
gatggtacacagtgcctttcgggcagttctgatgggacaattcgcctttggtcccttggc
caacagaggtgtatagcgacgtaccgagtccatgatgaaggcgtttgggctctgcaggtc
aatgacgccttcacacacgtgtattctggtggaagggacaggaagatttactgtacagac
ctaagaaaccctgacattcgggtactaatttgtgaagaaaaagcaccagttctcaagatg
gagcttgataggtcagctgatccccctcccgcaatctgggttgcgacgactaagtctaca
gtaaataaatggaccttgaagggaattcataatttcagagcctccggagattatgacaat
gactgtacaaatcctataacaccactttgtacgcagcctgaccaggttattaaagggggt
gctagtattattcagtgtcacattcttaatgataagagacatatattaaccaaagatacc
aataataatgtggcatattgggatgtattgaaggcatgtaaagttgaagatctgggcaaa
gtggattttgaggatgaaattaagaaaagatttaagatggtgtatgtgccaaattggttc
tcagtagacttaaaaacagggatgttgactattactttggatgagagtgattgttttgct
gcttgggtttctgcaaaagacgctggcttcagcagccctgacgggtcagatccaaaactg
aacttaggaggacttttactgcaggcactcctagaatattggcctagaacacacgtgaat
ccaatggatgaagaagaaaatgaagtaaaccatgtaaatggggagcaggagaaccgagtg
cagaagggaaatggatattttcaagtccccccccacactcctgtgatctttggtgaagct
gggggacgcacactgttcaggctgctctgccgagactccgggggtgagactgagtcgatg
cttcttaatgagacagtgccacaatgggtcattgacatcactgtggataaaaatatgccc
aaattcaacaaaattcctttctacctccaacctcacgcatcttcgggagcaaaaacctta
aaaaaagacagactctccgccagtgacatgctccaagtccggaaggtaatggaacacgtt
tacgagaaaatcatcaacttggataatgagtcgcaaaccactagctcttctaacaacgaa
aagccaggggaacaggaaaaagaggaggatattgctgtgctggcagaggagaaaatcgaa
cttttgtgccaggaccaggttttggatccaaacatggacctccggacggtgaagcacttc
atctggaagagcgggggcgacctcaccctccattaccgccagaagtccacgtga

DBGET integrated database retrieval system