KEGG   Acinonyx jubatus (cheetah): 106966666Help
Entry
106966666         CDS       T04657                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04015  Rap1 signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04510  Focal adhesion
aju04520  Adherens junction
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04670  Leukocyte transendothelial migration
aju04916  Melanogenesis
aju04919  Thyroid hormone signaling pathway
aju04934  Cushing syndrome
aju05100  Bacterial invasion of epithelial cells
aju05160  Hepatitis C
aju05163  Human cytomegalovirus infection
aju05165  Human papillomavirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
aju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    106966666 (CTNNB1)
   04310 Wnt signaling pathway
    106966666 (CTNNB1)
   04390 Hippo signaling pathway
    106966666 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106966666 (CTNNB1)
   04520 Adherens junction
    106966666 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    106966666 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    106966666 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    106966666 (CTNNB1)
   04916 Melanogenesis
    106966666 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106966666 (CTNNB1)
   05205 Proteoglycans in cancer
    106966666 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106966666 (CTNNB1)
   05225 Hepatocellular carcinoma
    106966666 (CTNNB1)
   05226 Gastric cancer
    106966666 (CTNNB1)
   05216 Thyroid cancer
    106966666 (CTNNB1)
   05217 Basal cell carcinoma
    106966666 (CTNNB1)
   05215 Prostate cancer
    106966666 (CTNNB1)
   05213 Endometrial cancer
    106966666 (CTNNB1)
   05224 Breast cancer
    106966666 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106966666 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    106966666 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106966666 (CTNNB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    106966666 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    106966666 (CTNNB1)
   05163 Human cytomegalovirus infection
    106966666 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106966666 (CTNNB1)
   05165 Human papillomavirus infection
    106966666 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 106966666
NCBI-ProteinID: XP_026896580
LinkDB All DBs
Position
Unknown
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaagctgatctgatggaactggacatggccatggagccagacagaaaagca
gctgtcagtcactggcagcaacagtcttacctggactctggaatccattctggcgccacc
accacagccccttctctgagtggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtacgagtgggaacaggggttttctcagtccttcactcaagaacaagtggct
gatattgatggtcagtatgcgatgacgcgagctcagagagtgcgagctgctatgttccct
gagactttagacgagggcatgcagatcccatccacacagttcgatgctgctcaccctact
aacgtccagcgtttggctgaaccatcacagatgctgaaacacgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccccgaactgacaaaactgcta
aacgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttcgaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgccatcgtacgc
accatgcagaatacgaacgacgtggagacagctcgctgtactgctggcaccttgcacaat
ctttctcatcatcgtgagggcttgctggccatctttaagtctgggggcattcccgccctg
gtgaagatgcttgggtcaccagtggattctgtattattttatgccattacaactctacac
aaccttttattgcatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacgacagactgc
cttcagattttagcttacggcaaccaagaaagcaagctgatcattctggctagtggtgga
cctcaagctttagtaaatataatgaggacctacacttacgagaaactactgtggaccaca
agcagagtactgaaggtgctgtctgtctgctctagtaataaaccagctattgtagaagcc
ggtggaatgcaagctttagggcttcacctgacagatccaagtcaacgtctcgttcagaac
tgtctttggactcttaggaatctatcagatgctgcgactaaacaggaagggatggaaggt
cttcttgggacccttgttcagcttctgggctcagatgatataaatgtggtcacctgtgca
gctggaattctttctaatctcacttgcaataattataagaataagatgatggtctgccaa
gtgggtggtatagaggcacttgtgcgtactgtccttcgtgctggtgacagggaggacatc
accgagcctgccatctgtgctcttcgtcatctgaccagtcgacaccaggaagcagagatg
gcccagaatgctgttcgtcttcactatggactaccggttgtggttaaactcctgcaccca
ccatcccattggcctctgataaaggccaccgttggattgattcgaaaccttgccctttgt
ccagcaaatcacgcacctctccgtgaacagggtgccattccacgactagttcagttgctg
gttcgtgcccatcaagatacccagcgccgcacatctatgggcggaacgcagcagcagttt
gtggagggagtccgtatggaagaaattgttgaaggttgtaccggagcccttcatatccta
gctcgggatgttcacaaccgaatcgtaatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagccgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcggaagccattgaagcggagggagccacggctcctctg
acagagctccttcactccagaaacgaaggtgtggcaacatacgcagctgctgttttgttc
cgaatgtctgaggacaagccccaggactacaagaagcggctctcggtggagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagagccccttggatatcgtcaggatgatcccagctaccgttcctttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggagcacgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcacgcccag
gacctcatggatgggctgcctccaggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system