KEGG   Acinonyx jubatus (cheetah): 106966786
Entry
106966786         CDS       T04657                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04020  Calcium signaling pathway
aju04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106966786 (CACNA1E)
   04020 Calcium signaling pathway
    106966786 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    106966786 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aju04040]
    106966786 (CACNA1E)
Ion channels [BR:aju04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106966786 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DPBB_1
Other DBs
NCBI-GeneID: 106966786
NCBI-ProteinID: XP_026930210
UniProt: A0A6J2AP93
LinkDB
Position
Unknown
AA seq 2459 aa
MVPEMRGPSPGRRLPEPAPCPAAGGNPEPWALGRRHRHVLALPEEEAWRPQQCALLEADA
SDEVGMLPASPRAVAAGFDNFFPVQEGEGPGWEGGAALEAGSSPFLPVSPEVMKRRRGGL
IEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVPAS
GPAAAYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEY
MILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKG
SYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKS
IMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFTNSSGILEGFDPPHPCGVQGC
PAGYECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIP
LIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEV
MLAEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVD
GASYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEF
LFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRA
LRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFND
GTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYT
LLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRR
HHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNP
LSPLNPLNAHPSLYRRPRPIEGLGLGLEKCEEERISRGGSLKGDGGDLPSALDNQRSPLS
LGKREPPWLAKPCHGNCDSTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTEGKEPSS
TSRSRSASQERSLDEGGPTEGEKDREPRASHGGKEPTIQEEERGQDLRRTNSLMVPRGSG
LAGALDEANTPLVQPQPELEMGKDTALTEQEPEGSSEQALLGDVQLDMGRAISQSEPDLS
CVTANTDKATTESTSVTVTIPDVGPLVDSTVVHISNKTDGEASPLKEAEIKEEEEEVEKK
QQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAED
PVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGAL
VAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILI
VYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFH
YDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFF
VNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHF
VVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGF
LNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIR
ILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLM
LLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLM
LNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPP
LGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSE
LQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQK
NAPMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDP
ADDGQFQEQQSLEPEVSELKSVQSSNHGIYLPSDTQEHTGSGRASSMPRLTVDPQVVTDP
SSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSD
THRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERHESRSPSEGRSQTPNRQG
TGSLSESSIPSISDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHTGSMSPPADGSEGGSP
LASQALESPEASLAESSSSRHVQQGQHASPQRYISEPYLALHEDSHASDCGEEETLTFEA
AVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGVMCGAVSDLLSDTEEDDKC
NT seq 7380 nt   +upstreamnt  +downstreamnt
atggtgccggagatgcgtggaccgagcccaggccgcaggctgcccgagcccgccccctgc
cccgccgcaggcgggaaccctgagccctgggccttgggccgccgccaccgccacgtccta
gccctgcctgaggaggaggcatggcggccccagcagtgcgccctgctcgaggccgacgcc
tcggacgaggtgggcatgctgcccgcctccccgcgtgccgtcgccgcgggcttcgacaac
ttcttcccggtgcaggagggtgagggccccggctgggagggcggcgcggccctggaagct
ggctccagcccgttcctcccggtgagccccgaggtgatgaagcggcggcgtggggggctc
atcgagcagcgcgacatcatcaaggcccacgaggcgcacaagatgcagagcaccccgcaa
gcccggcgcaaggagtgggagatggctcgcttcggggaggcggtggtcggcaggccgggg
tcgggcgatggagactcggaccagagcaggaaccggcaaggaaccccggtgccggcctcg
gggccagcggccgcctacaagcagtcgaaagcgcagagggcgcggactatggctttgtac
aaccccattcccgtccggcagaactgtttcaccgtcaacagatccctgttcatcttcgga
gaagataatattgtcaggaaatacgccaagaagctcatcgattggccgccgtttgagtac
atgattttggccaccatcattgccaactgcattgtcttggccctggaacagcatcttcct
gaggatgacaagaccccgatgtcccgcagactggaaaagacagaaccatatttcattggg
atcttttgctttgaagctggtatcaaaattgtggccctggggttcatcttccataagggc
tcgtacctccgcaatggctggaatgtcatggatttcatcgtggtcctcagtggcatcctg
gctacggcaggaacccacttcaacacacatgtggacctgaggacccttcgggctgtgcgt
gtcctgaggcccctgaagctcgtgtcagggatacctagcctacagattgtgttgaagtcc
atcatgaaggccatggtgcctcttctgcaaattggccttctgctcttctttgccatcttg
atgttcgccatcattggcttggagttctacagtgggaagttgcaccgggcatgtttcacg
aacagttcaggtattctagaaggatttgaccctcctcacccatgtggtgtgcagggctgc
ccagctggttatgaatgcaaggactggattggccccaacgatgggatcacccagtttgat
aacatcctttttgctgtgctgactgtcttccaatgcatcaccatggaaggatggaccacc
gtgctgtacaataccaatgatgccttaggagccacctggaattggctgtacttcatcccc
ctcatcatcattggatccttctttgttctcaacctcgttctgggagtgctttccggggaa
tttgccaaagagagagagagagtggagaaccggagagctttcatgaaattgcggcggcag
cagcagattgagcgtgagctgaatgggtaccgcgcctggatagacaaagcagaggaagtc
atgcttgctgaagaaaataaaaacgctggaacatcagccttagaagtgcttcgaagggca
accatcaaaaggagccggacagaggccatgactcgagactccagcgatgagcactgtgtt
gatatctcctctgtgggcacacctcttgcccgagccagcatcaaaagtgcaaaggtggat
ggggcctcctatttccggcacaaagaaaggcttctgcgcatctctatccgccacatggtc
aaatcccaggtgttttactggattgtgttgagccttgtggctctcaacactgcctgtgtg
gccatcgtccatcacaaccagccccagtggctcacccatctcctctactatgcagaattt
ctgtttctgggactgttcctcttggagatgtccttgaagatgtatggcatggggcctcga
ctttactttcactcttcattcaactgttttgattttggggtcacagtgggcagtatcttt
gaagtggtctgggcaatcttcagacctggtacatcttttggaatcagtgtcttgcgagct
ctccggcttctaagaatatttaaaataaccaagtattgggcatctctgcgaaatctggtg
gtctccttgatgagttctatgaagtctatcatcagtttgctcttcctcctcttcctcttc
atcgttgtctttgctctcctaggaatgcagctgtttggaggcaggtttaactttaatgat
gggactccttcagcaaactttgacacctttccggcagccatcatgactgtattccagatc
ctaacaggtgaggactggaatgaggttatgtacaatgggatccgctcccagggtggagtt
agctcaggcatgtggtcagctatctatttcattgtgctcaccttgtttggaaactacaca
ctgctgaatgtgttcttggccattgctgtagacaatctggccaatgcccaagagctgacc
aaggatgaacaagaagaagaggaggccttcaaccagaaacatgcattgcagaaggccaag
gaggtcagcccgatgtctgcacccaacatgccttctatcgaaagagacagaaggagaaga
caccacatgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgccggcac
cacatgtcagtgtgggagcagcgcaccagccagctgagaaggcacatgcagatgtccagc
caggaggccctcaacaaagaggaggccccaccaatgaaccccctcaaccccctcaacccg
ctgagccccctcaacccactcaacgcccacccgagcctctaccggagacccagacccatt
gagggcctgggcctgggcctggagaaatgtgaggaggagcgcattagccgcggggggtcc
ctcaagggggacggaggggacctgccgagtgccttggacaaccagaggagccccttgtcc
ttgggcaaacgggagccaccatggctggccaagccgtgtcatgggaactgtgattcgacc
cagcaggaggctgggggaggggagactgtggtgaccttcgaggaccgggccaggcacagg
cagagccagcggcgcagcaggcaccgtcgtgtcaggaccgaaggcaaggaaccctcctcc
acctcccggagcaggtctgccagccaggagcggagtctggatgaaggggggcccaccgag
ggggagaaggaccgagagcccagggccagccatgggggcaaggaacccacaatccaggaa
gaggaaagaggccaagacttaaggaggaccaacagtctgatggtgcccagaggctctggg
ctggcaggagccctcgacgaggccaacacacccttagtccagccgcagccagagttggaa
atggggaaggacacggctctgacagagcaggagccggagggcagcagtgagcaagctctg
ctgggggatgtgcagttggacatgggccgggccatcagtcagagtgagcccgacctctcc
tgtgtcacggccaacacggacaaggccaccactgagagtaccagcgtcaccgtcaccatc
cccgacgtgggccccttggtggactcaactgtggttcacattagcaacaagactgatgga
gaagccagtcctttgaaggaggcagagatcaaagaggaggaggaagaggtagagaagaag
cagcaaaagaaggagaagcgtgagacgggcaaagccatggttccgcacagctctatgttc
atcttcagcaccaccaacccgattcgcagggcctgccactacattgtgaacctgcgctac
tttgagatgtgcattctcctggtgatcgcagccagcagcattgccctggcagccgaggac
cctgtcctgaccaactcggagcgcaacaaagtcctgaggtattttgactatgttttcact
ggcgtgttcacctttgagatggttataaagatgatagaccagggcttgatcctgcaggat
gggtcctacttccgagacctatggaacatcctggactttgtggtggtggttggcgcattg
gtggcctttgctttggcgaacgccttgggaactaacaaggggcgggacatcaagaccatc
aaatctctgagggtgctccgagttctgagaccgctgaagaccatcaagcgcttgcccaag
ctcaaggctgtctttgattgcgtggtgacttccttgaagaatgtcttcaacatactcatt
gtctacaagctcttcatgttcatcttcgctgtcatcgcagttcagctcttcaagggaaag
ttcttttattgcacggacagttccaaggacacagagaaggagtgcataggcaactatgta
gatcatgaaaaaaacaagatggaggtgaaaggccgggaatggaagcgccatgaattccac
tacgacaacattatctgggccctgctgaccctcttcactgtctccacaggggaaggatgg
cctcaagtcttacagcattctgtcgatgtgacagaggaagaccgaggaccaagccgcagc
aaccgcatggagatgtccatcttttacgtggtctactttgtggtcttccctttcttcttt
gtcaatatctttgtggctctcatcatcatcaccttccaggagcaaggagacaagatgatg
gaggagtgcagcctggagaagaacgagagggcgtgcatcgacttcgccatcagtgccaaa
cctctcacccgctacatgccgcagaacaggcataccttccagtaccgcgtctggcacttc
gtggtgtcgccgtcctttgagtacaccattatggccatgatcgccttgaacaccgtcgtg
ctgatgatgaagtactactctgctccctgtacctatgaactggccctgaagtacctgaat
attgccttcaccatggtgttttctctggaatgtgtcctaaagatcatcgcgtttggcttc
ttgaactattttcgagatacctggaatatctttgactttatcaccgtgattggcagtatc
acagaaatcattctgacagacagcaagctggtgaacaccagtggcttcaatatgagcttt
ctgaagctcttccgagctgctcgtctcatcaagcttctacgtcagggctacaccatccgt
attttactttggacttttgtacagtcctttaaggccctcccctacgtctgccttttgatt
gccatgcttttcttcatctatgccatcatcgggatgcaggtattcggaaacataaaatta
gatgaggagagtcacatcaaccgacacaacaacttccggagtttcttcgggtccctcatg
ttgctcttcaggagtgccacaggtgaggcctggcaggagataatgctgtcgtgcctcggg
gagaaaggctgtgagcccgacaccactgcgccatcagggcagaatgagaatgagcgctgt
ggcaccgatctggcctatgtttactttgtctccttcatcttcttctgctccttcttgatg
ctcaacctgtttgtggccgtcatcatggacaactttgagtacctgactcgggactcatcc
atcctagggcctcaccacttggacgagtttgtccgcgtctgggcagaatatgacagagct
gcatgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccg
ctaggcctcggcaagagatgtccctccaaagtggcatataagaggttggtcctgatgaat
atgccagtagctgaggacatgaccgtccacttcacctccacactcatggctctgatacgg
acagcactggacatcaaaatcgccaaaggtggtgcagacagacagcagctagactcagaa
ctacaaaaggagaccctggccatctggcctcacctgtcccagaagatgctagatctgctc
gtgcccatgcccaaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatc
atggactactataaacagagtaaggtgaagaagcagaggcagcagctggaggaacagaaa
aacgcacccatgttccagcgcatggagccttcatctctgcctcaggagatcattgctaat
gccaaagccctgccttatctccagcaggaccctgtctcaggcttgagtggccgtagtgga
tacccttcgatgagtccgctctccccccaggaaatattccagttggcttgtatggaccca
gccgatgatggacagtttcaggaacagcagtctctggagccagaggttagtgaattaaaa
agcgtgcagtcctctaaccatggcatctaccttccttcggacacccaggagcatacggga
tctgggagggcatcctctatgccacgcctgactgtggatccccaggtggtgacagaccct
agctccatgagacgctcattttccaccattcgggataagcgttcaaattcctcatggttg
gaggaattctctatggagagaagcagtgaaaacacctacaagtcacgtcgccggagttac
cactcctccctgagactgtcagctcatcgcctgaattctgactcaggccacaagtctgac
acccaccgctcagggggcagagagcggggacggtcaaaagagcgaaagcatcttctctct
cccgatgtctcccgctgcaactcagaggagcgagggacccaggctgactgggagtccccc
gagcgccatgagtccaggtctcccagcgagggcaggtcacagacccccaacagacagggc
acgggttccctgagtgagagctccatcccctccatctctgacaccagcactccgagacga
agtcgccggcagctcccgcccgtgccaccaaagcctcgtcccctcctttcctacagctcc
ctgattcgacacaccgggagcatgtctccaccggctgatggaagcgagggtggctctccg
ctggcctcccaagccctggagagccctgaggccagcctggcggagtcttccagctcccgg
cacgtacagcagggtcagcacgcctccccacagcgctacatctccgagccctacctggcc
ctgcacgaagactcccacgcctcggactgtggcgaggaggagacactcaccttcgaagca
gctgtggccaccagcctgggccgctccaacaccatcggctcggccccaccgctgcggcac
agctggcagatgcccaatgggcactatcgacggcggaggcgcggggggcccgggccaggt
gtgatgtgtggggctgtcagcgacctcctgagtgacacggaagaggacgacaagtgctag

DBGET integrated database retrieval system