KEGG   Acinonyx jubatus (cheetah): 106966916Help
Entry
106966916         CDS       T04657                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega-2 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00480  Glutathione metabolism
aju00980  Metabolism of xenobiotics by cytochrome P450
aju00982  Drug metabolism - cytochrome P450
aju00983  Drug metabolism - other enzymes
aju01100  Metabolic pathways
aju01524  Platinum drug resistance
aju05200  Pathways in cancer
aju05204  Chemical carcinogenesis
aju05225  Hepatocellular carcinoma
aju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106966916 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106966916 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    106966916 (GSTO2)
   00983 Drug metabolism - other enzymes
    106966916 (GSTO2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106966916 (GSTO2)
   05204 Chemical carcinogenesis
    106966916 (GSTO2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106966916 (GSTO2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106966916 (GSTO2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106966916 (GSTO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aju02000]
    106966916 (GSTO2)
Enzymes [BR:aju01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106966916 (GSTO2)
Transporters [BR:aju02000]
 Other Transporters
  Pores ion channels [TC:1]
   106966916 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 106966916
NCBI-ProteinID: XP_026918812
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MEDATRTFGKGSCPPGPVPEGLIRVYSMRFCPFAHRTRLVLRAKGIRHEVININLRNKPE
WYYTKHPFGQIPVLENSKCQLIYESVIACEYLDDAYPGRKLYPYDPYERARQKMLLELFY
KVPHLTKECLVAIRCGRECADLKLALRQEFCNLEEILGYQNTVFFGGDCISMIDYLFWPW
FERLDVYGIADCLNHTPALRLWTAAMKQDPTVCALLIDRSIFLGFLNLYFQNNPDAFDYG
LTC
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgcgaccaggacctttgggaaaggaagctgccccccggggcccgtcccagag
ggcctgatccgcgtctacagtatgaggttctgcccctttgcgcacaggacgcgccttgtc
ctccgggccaaaggcatcagacatgaagtaatcaacattaacctgagaaacaagcctgaa
tggtactatacaaagcacccttttggccaaattcctgtcctggagaacagcaaatgtcag
ttgatctatgaatctgtcatcgcctgtgagtacctggatgatgcttatcctggaaggaag
ctgtatccatatgacccttatgagcgggctcgccagaagatgttattggagctattctat
aaggtcccacatttgaccaaggagtgtctggtggccataagatgtgggagagaatgtgct
gatctgaagctagccctgcgtcaggaattctgcaaccttgaagagattcttggctatcag
aacaccgtcttctttggtggagactgtatatccatgatcgattacctcttctggccctgg
tttgagcggctggatgtgtatggaatagctgactgtttgaaccacacgccagctctccgg
ctctggacagcagccatgaagcaggaccccacagtgtgtgcccttctcatagataggagc
attttcctgggcttcttgaatctttattttcagaacaaccctgatgcttttgattatggg
ctaacttgctga

DBGET integrated database retrieval system