KEGG   Acinonyx jubatus (cheetah): 106967086Help
Entry
106967086         CDS       T04657                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00590  Arachidonic acid metabolism
aju01100  Metabolic pathways
aju04064  NF-kappa B signaling pathway
aju04370  VEGF signaling pathway
aju04625  C-type lectin receptor signaling pathway
aju04657  IL-17 signaling pathway
aju04668  TNF signaling pathway
aju04723  Retrograde endocannabinoid signaling
aju04726  Serotonergic synapse
aju04913  Ovarian steroidogenesis
aju04921  Oxytocin signaling pathway
aju04923  Regulation of lipolysis in adipocytes
aju05140  Leishmaniasis
aju05163  Human cytomegalovirus infection
aju05165  Human papillomavirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05200  Pathways in cancer
aju05204  Chemical carcinogenesis
aju05206  MicroRNAs in cancer
aju05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106967086 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106967086 (PTGS2)
   04064 NF-kappa B signaling pathway
    106967086 (PTGS2)
   04668 TNF signaling pathway
    106967086 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106967086 (PTGS2)
   04657 IL-17 signaling pathway
    106967086 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    106967086 (PTGS2)
   04913 Ovarian Steroidogenesis
    106967086 (PTGS2)
   04921 Oxytocin signaling pathway
    106967086 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    106967086 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    106967086 (PTGS2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    106967086 (PTGS2)
   05206 MicroRNAs in cancer
    106967086 (PTGS2)
   05204 Chemical carcinogenesis
    106967086 (PTGS2)
   05222 Small cell lung cancer
    106967086 (PTGS2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    106967086 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106967086 (PTGS2)
   05165 Human papillomavirus infection
    106967086 (PTGS2)
   05140 Leishmaniasis
    106967086 (PTGS2)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     106967086 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 106967086
NCBI-ProteinID: XP_014918759
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAALALCRAANPCCSNPCQNQGVCLSIGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLQNIIMKYVLTSRSHLIESPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLSHVYGETLDRQHKLRLFKDGKMKY
QIIDGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFVYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYTSFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccgcgccttgctgctctgcgccgccctggcgctctgccgtgcagcaaatcct
tgctgttccaacccatgccaaaaccaaggtgtatgcctgagcataggatttgaccagtat
aagtgtgactgtacccgaacaggattctatggtgaaaactgttcaacacctgaatttctg
acaagaataaagttattcctgaaacccactccaaatacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgcaaaatataattatgaaa
tatgtgttgacatccaggtcacatttgatcgagagcccaccaacttacaatgtggactat
ggctataaaagctgggaagccttttccaatctctcctattataccagagctcttccccct
gtggctgatgactgcccaacacccatgggtgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaaatttcttctaagaagaaagttcattcctgacccccaaggcaca
aatatgatgtttgcattttttgcccaacacttcacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccaaaggactgggccatggggtggacttaagtcatgtttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatac
cagataatcgatggggaggtgtatcctcccacagtcaaagatactcaggtcgagatgatc
tacccacctcatgttcctgaacacctgcggtttgctgtgggccaggaggtctttggtctg
gtgcctggtctgatgatgtacgccacaatttggctgcgggaacacaacagagtgtgtgat
gtgcttaaacaggagcatccagaatgggatgatgagcggttgttccagacgagcaggcta
atactgataggagaaaccattaagattgtgattgaagactatgtacaacacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccaataccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacacc
ttgcaaatagatgaccaggagtacaatttccagcagtttgtctacaacaactctatatta
ctggaacatgggcttacccagttcgtggaatcattcagcaggcaaattgctggcagggtt
gctggtggtaggaatgttccagctgcagtgcagcaagtagcaaaggcctccatcgaccag
agcagacagatgaagtaccagtctcttaatgagtatcgcaaacgctttcggctgaagccc
tatacatcgtttgaagaactcacaggagagaaggaaatggctgcggggttagaagcactt
tatggtgatattgatgccatggagctgtatcctgcccttctggtagaaaagcctcgccct
gatgccatctttggtgagaccatggtagaaatgggagcaccattctccttgaaaggactt
atgggtaatcctatatgttctcctgactactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcgattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgcattcagtgttcaagatccacagctcaccaaaacagtcaccattaat
gcaagctcttcgcactctggactggatgatatcaatcccacagtactgctaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system