KEGG   Acinonyx jubatus (cheetah): 106967100
Entry
106967100         CDS       T04657                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106967100 (FZD5)
   04390 Hippo signaling pathway
    106967100 (FZD5)
   04150 mTOR signaling pathway
    106967100 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106967100 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106967100 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106967100 (FZD5)
   05205 Proteoglycans in cancer
    106967100 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106967100 (FZD5)
   05226 Gastric cancer
    106967100 (FZD5)
   05217 Basal cell carcinoma
    106967100 (FZD5)
   05224 Breast cancer
    106967100 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106967100 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    106967100 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106967100 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106967100 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    106967100 (FZD5)
G protein-coupled receptors [BR:aju04030]
 Frizzled / Smoothened family
  106967100 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 106967100
NCBI-ProteinID: XP_026908213
UniProt: A0A6J1YU58
LinkDB
Position
Unknown
AA seq 589 aa
MARPDPSAPPSLLLLLLAQLAGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPAGAPASGG
ECAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGATAAGDYEASASLTGRTGPPGPAAAAAAAAYHKQVSLSHV
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccgtccgcaccgccctccctgctgctgctgctcctggcgcagctg
gcgggccgggcggcggctgcctccaaggccccagtgtgccaggaaatcacagtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccactgctcgccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcctgcccgactaccacaag
ccgctgccgccctgccgctccgtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccagtacggcttcgcctggccggagcgcatgagctgcgaccgcctcccggtgctgggc
cgcgacgccgaggtcctgtgcatggattacaaccgcagcgaggccaccacggcgcccccc
aggcccttcccggccaaacccaccctcccgggccccgcgggcgcaccggcctcaggaggc
gagtgcgccgccgggggcccgtcggtgtgcaagtgccgcgagcccttcgtccccatcttg
aaggagtctcacccgctctacaacaaggtgcgcacgggccaggtgcccaactgcgccgtg
ccctgctaccagccctccttcagccccgacgagcgcacgttcgccaccttctggattggg
ctgtggtctgtgctgtgcttcatctccacctccaccacggtagccaccttcctaatagac
atggaacgcttccgctaccctgagcgtcccatcatcttcctgtctgcctgctacttgtgc
gtgtcgctgggcttcctggtgcgcctggtggtgggccacgccagcgtcgcctgcagccgc
gagcacagccacattcactacgagacgacgggccctgcgctgtgcactgtcgtcttcctg
ctggtctacttctttgggatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcagctggcatgaagtggggcaacgaggccatcgcgggctatgcacagtacttc
cacctggccgcgtggctcatccccagcgtcaagtccatcacggcgctggcactgagctcc
gtggatggggacccggtggccggcatctgctacgtgggcaaccagaacctgaactcgctg
cgcggcttcgtgctgggcccgctggtgctctacctgctggtgggcaccctcttcctcctg
gcggggttcgtgtcgctcttccgcatccgaagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctcatgatccgtatcggtatcttcactctcctgtacaccgtgccc
gccagcatcgtggtggcctgctacctgtacgagcagcactatcgcgagagctgggaggcc
gcactcacctgcgcgtgcccgggccccgacgccggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctcgtggtgggcatcacgtcgggcgtctgg
atttggtccggcaagactgtggagtcgtggcggcgcttcaccagccgatgctgctgccgc
ccgcggcggggccacaagagcggcggcgccacggccgcgggggactatgaggcgagcgcc
tcgctcacgggcaggaccgggccgccgggccccgccgccgccgccgccgccgccgcctac
cacaagcaggtgtccctgtcgcacgtgtag

KEGG   Acinonyx jubatus (cheetah): 106967740
Entry
106967740         CDS       T04657                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4 isoform X3
  KO
K02354  frizzled 4
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106967740 (FZD4)
   04390 Hippo signaling pathway
    106967740 (FZD4)
   04150 mTOR signaling pathway
    106967740 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106967740 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106967740 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106967740 (FZD4)
   05205 Proteoglycans in cancer
    106967740 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106967740 (FZD4)
   05226 Gastric cancer
    106967740 (FZD4)
   05217 Basal cell carcinoma
    106967740 (FZD4)
   05224 Breast cancer
    106967740 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106967740 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    106967740 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106967740 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106967740 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    106967740 (FZD4)
   04090 CD molecules [BR:aju04090]
    106967740 (FZD4)
G protein-coupled receptors [BR:aju04030]
 Frizzled / Smoothened family
  106967740 (FZD4)
CD molecules [BR:aju04090]
 Proteins
  106967740 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 106967740
NCBI-ProteinID: XP_014919532
UniProt: A0A6I9ZFQ5
LinkDB
Position
Unknown
AA seq 433 aa
MCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGD
EEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMA
VWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDF
EEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHS
SYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTL
FIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWAL
FRYSADDSNTAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGN
GWVKPGKGNETVV
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtgcacagagaagatcaacatccccatcggcccatgtggcggcatgtgtctttcggtc
aagaggcgctgtgaacctgtcctgaaggaatttggctttgcctggccagagagcctgaac
tgcagcaaattcccaccccagaatgaccacaaccacatgtgcatggaagggccgggtgat
gaagaggtgccattacctcacaagacccccatccagcctggagaagagtgccactccgta
ggaaccaactcggatcagtacatctgggtgaaaaggagtttgaactgtgttctcaagtgt
ggctatgatgctggcttatatagtcgctcggccaaggagttcacagatatctggatggcc
gtgtgggccagcctgtgcttcatctccactgccttcacagtgctgaccttcctgatcgat
tcttccaggttttcctaccctgagcgccccatcatatttctcagtatgtgctataatatt
tatagcattgcttatattgtcaggctgactgtaggccgggaaaggatatcctgcgatttt
gaagaggcagcagaacctgttctcatccaagaaggacttaagaacacaggatgtgcaatc
attttcttgctgatgtactttttcggaatggctagttccatctggtgggttatcctgaca
cttacttggtttttagcggcaggactcaagtggggtcatgaagccattgaaatgcacagc
tcttatttccacattgccgcctgggccatccctgcagtgaaaaccattgtcatcttgatc
atgagactggtggacgctgatgaactcactggcctgtgctatgtgggaaaccaaaacctc
gatgccctcacaggctttgtggtggcccccctcttcacttacttggtgataggaactttg
ttcatcgctgcaggtttagtggccttgttcaaaattcggtccaatcttcaaaaggatggg
acaaagacagacaagctggaaaggctgatggtcaagattggggtcttctctgtcttgtac
acggttcctgccacctgtgtgatcgcctgttatttctatgaaatctccaactgggcgctc
ttccggtattctgcagatgactccaatacagcagtcgaaatgttgaaaatttttatgtct
ttgctggtgggcatcacttcaggcatgtggatttggtctgccaaaactcttcacacgtgg
cagaagtgttctaacagattggtgaattctgggaaggtgaagagagagaagcgaggaaat
gggtgggtgaagcctgggaaaggcaatgaaactgtggtataa

KEGG   Acinonyx jubatus (cheetah): 106974284
Entry
106974284         CDS       T04657                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106974284 (FZD2)
   04390 Hippo signaling pathway
    106974284 (FZD2)
   04150 mTOR signaling pathway
    106974284 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106974284 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106974284 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106974284 (FZD2)
   05205 Proteoglycans in cancer
    106974284 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106974284 (FZD2)
   05226 Gastric cancer
    106974284 (FZD2)
   05217 Basal cell carcinoma
    106974284 (FZD2)
   05224 Breast cancer
    106974284 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106974284 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    106974284 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106974284 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106974284 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    106974284 (FZD2)
G protein-coupled receptors [BR:aju04030]
 Frizzled / Smoothened family
  106974284 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 106974284
NCBI-ProteinID: XP_014926956
UniProt: A0A6I9ZTK6
LinkDB
Position
Unknown
AA seq 565 aa
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGTPALLTTAPPPGLQPGAGGTP
GGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctgccgctgctgctgctgcccgccgcc
gggccggcccagttccacggggagaagggcatctccatcccagaccacggcttctgccag
cccatctccatcccgctgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccatacgaaccaggaggacgcgggcctggaggtgcaccagttctacccgttggtg
aaggtgcagtgctcccccgaactgcgcttcttcttgtgctccatgtacgcacccgtgtgc
accgtgctggagcaggccatcccgccgtgccgctccatctgcgagcgcgcgcgccagggc
tgtgaggcgctcatgaacaagttcggtttccagtggcccgagcgcctgcgctgcgagcac
tttccgcgccacggcgcggagcagatctgcgtgggccaaaaccactccgaagacggcacg
cccgcgctgctcactaccgcgcctccgcctggcctgcagccgggtgccgggggcaccccg
ggcggcccgggcggcggcggctcgcccccgcgctacgccacgctggagcaccctttccac
tgcccgcgcgtcctcaaggtgccatcctatctcagttacaagtttctgggcgagcgcgac
tgcgcggcgccctgtgagccggcgcggcccgacggctccatgttcttctctcaggaggag
acgcgcttcgcgcgcctctggatcctcacctggtcggtgctgtgctgcgcctccaccttc
ttcaccgtcactacctacctggtagacatgcagcgcttccgctacccggagcgacccatc
atctttctgtccggctgctacactatggtctcggtggcctacatcgcgggcttcgtgctc
caggagcgcgtcgtgtgtaacgagcgcttttccgaggacggctaccgcacagtggtgcag
ggcaccaagaaggagggctgcaccatcctctttatgatgctgtacttcttcagtatggcc
agttccatctggtgggtcatcctgtctctcacctggttcctggcggcgggcatgaagtgg
ggccacgaggccatcgaggccaactcccagtacttccacctggccgcgtgggccgtgccg
gcggtcaagaccatcactatcctggccatgggccagattgacggcgacctgctgagcggc
gtgtgtttcgtgggcctcaacagcctggacccgctgcggggcttcgtgctggcgccgctc
ttcgtgtacctgttcataggcacgtcctttctcctggctggtttcgtgtcactcttccgc
atccgtaccatcatgaagcacgacggcaccaagacggagaagctggagcggctcatggtg
cgcatcggcgtcttctcggtgctctacaccgtgcctgcgaccatcgtcatcgcctgctac
ttctacgagcaggcctttcgagagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtcacccgacttcaccgtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tccggcaagacgctgcactcgtggaggaagttctacacccgtctcaccaacagccggcac
ggcgagaccaccgtgtga

KEGG   Acinonyx jubatus (cheetah): 106978285
Entry
106978285         CDS       T04657                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7 isoform X1
  KO
K02432  frizzled 1/7
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106978285 (FZD7)
   04390 Hippo signaling pathway
    106978285 (FZD7)
   04150 mTOR signaling pathway
    106978285 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106978285 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106978285 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106978285 (FZD7)
   05205 Proteoglycans in cancer
    106978285 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106978285 (FZD7)
   05226 Gastric cancer
    106978285 (FZD7)
   05217 Basal cell carcinoma
    106978285 (FZD7)
   05224 Breast cancer
    106978285 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106978285 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    106978285 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106978285 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106978285 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    106978285 (FZD7)
G protein-coupled receptors [BR:aju04030]
 Frizzled / Smoothened family
  106978285 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 106978285
NCBI-ProteinID: XP_026909047
UniProt: A0A6J1YV23
LinkDB
Position
Unknown
AA seq 629 aa
MRGPGVAASRSPLGLCTLVLALLGALPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYMPDLPFTALPPGAADGRGRSAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSEDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAACNICQQDNWISKRGKGPITGDFIAET
AKQQPSTPEDPRRGLPVYTMGIVITYNKN
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgcggggccccggcgtggccgcgtcgcgctcgcccctgggcctgtgcactctagtgctt
gcgctgctgggcgcgctgcccgccggtgccggggcgcagccttaccacggcgagaagggc
atctcggtaccggaccacggcttctgccagcccatctccatcccactatgcacggacatt
gcctacaaccagaccatcctgcccaacctgctaggccacacgaatcaagaggacgcgggc
ctcgaggtacaccagttctacccgctggtgaaggtgcagtgttctcccgagttgcgcttc
ttcctgtgctctatgtacgcacccgtgtgcacggtgcttgatcaggccatcccgccgtgc
cgttctctgtgcgagcgtgcccgccagggctgcgaagcgctcatgaacaagttcggcttc
cagtggccagagcggctgcgctgcgagaacttcccggtgcacggcgccggcgagatctgc
gtgggccagaacacgtccgacggctccgggggcccaggtggcggccccacagcctacccc
accgcgccctacatgccggacttgcccttcaccgcgctgcccccgggggccgctgacggc
aggggccgttctgccttccccttctcttgtccccgccagctcaaggtgcccccctacctg
ggctaccgcttcctgggcgagcgcgactgcggcgccccgtgcgagccgggccgtgccaac
ggcctaatgtactttaaggaagaggagaggcgctttgcccgtctctgggtgggcgtgtgg
tcggtgctgtgctgcgcctcgacgctcttcaccgtgctcacctatttagtggacatgagg
cgcttcagctatcccgagcggcccatcatctttctgtcgggctgctacttcatggtggcc
gtggcgcacgtggccggctttctgctggaggaccgcgcggtgtgcgtggagcgcttctca
gaagacggctaccgcacggtggcgcagggcaccaagaaggagggttgcactatcctcttc
atggtgctgtacttcttcggcatggccagttccatctggtgggtcatcctgtcgctcact
tggttcctggcagctggcatgaagtggggccatgaggccattgaagccaactctcagtat
ttccacctggccgcgtgggccgtgcccgctgtcaagaccatcaccatcttggccatgggc
caggtggatggggacttgctcagtggggtttgctacgtgggcctgtccagcgtggatgcg
ctgcgaggcttcgtgttggcgcctctgttcgtctacctcttcattggcacgtccttcctg
ctggccggcttcgtgtcgctcttccgcatccgcaccatcatgaagcacgacggaaccaag
accgagaaactggagaagcttatggtgcgcatcggcgtcttcagcgtgctttacactgtg
ccagcgaccatcgtcctggcctgctacttctatgagcaggccttccgcgaacactgggag
cgcacctggctcctgcagacttgcaagagctacgcggtgccctgcccgcctggccatttc
ccgcccatgagccctgacttcactgtcttcatgatcaagtacctgatgaccatgatcgtg
ggcatcaccactggcttctggatctggtccggcaagactctgcagtcgtggcgccgcttc
tatcacagactcagccacagcagcaagggggagactgcggcttgcaacatttgccagcaa
gataactggatttccaaaagagggaagggtccaatcacaggagactttatagcagaaaca
gcaaaacaacagccaagcactccagaggaccctagaagaggattgccggtctacacaatg
ggcatagtaattacatacaataaaaactga

KEGG   Acinonyx jubatus (cheetah): 106980059
Entry
106980059         CDS       T04657                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106980059 (FZD6)
   04390 Hippo signaling pathway
    106980059 (FZD6)
   04150 mTOR signaling pathway
    106980059 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106980059 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106980059 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106980059 (FZD6)
   05205 Proteoglycans in cancer
    106980059 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106980059 (FZD6)
   05226 Gastric cancer
    106980059 (FZD6)
   05217 Basal cell carcinoma
    106980059 (FZD6)
   05224 Breast cancer
    106980059 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106980059 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    106980059 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106980059 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106980059 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    106980059 (FZD6)
G protein-coupled receptors [BR:aju04030]
 Frizzled / Smoothened family
  106980059 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec RseC_MucC
Other DBs
NCBI-GeneID: 106980059
NCBI-ProteinID: XP_026919896
UniProt: A0A6J1ZR57
LinkDB
Position
Unknown
AA seq 712 aa
MEMFPFLWTCIFLPFIRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSTAAVKMEL
FLPLANLECSPNVETFLCKAFVPTCTEQIRVVPPCRKSCEKVYSDCKKLIDTFGIRWPEE
LECDRLQYCDETVPVTFDPHTQFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGNRTACNKADEKLELGDTVVLGSQNKACTVLFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCFCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRMTWEITWVSDHCRQYHIPCPYQAKTETRPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFRRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITDHDYLGQETLTEIQTSPETSVREV
RADGASTPRSREQDCGDPASPAASSSKLCGEQADGKGRAGKGNDKISVSESTRSEGRMTP
KSDVPETGPVQSSGLQVPGSAEPGSLKGSTSLLVHSASGGGKEQAAGGHSET
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaatgtttccatttttgtggacgtgtatttttctacccttcatacgaggacacagt
cttttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatttaatgggtcattatgaccagagtacagctgctgtgaaaatggagctt
tttcttcctcttgcaaatttggaatgttcaccaaatgttgaaactttcctttgcaaagct
tttgtaccaacctgtacagaacaaattcgtgtggttccaccttgtcgtaaatcttgtgag
aaagtatattctgattgcaaaaagttaattgacacttttggtatccgatggcctgaagaa
cttgaatgtgacagattgcaatactgtgatgagactgttcctgtaacttttgatccacac
acacagtttcttggtcctcagaagaaaacagagcaagtccaaagagacatcggattttgg
tgtcccaggcatcttaagacttctgggggacaaggctataagtttctgggaattgaccag
tgtgcacctccgtgccctaacatgtattttaaaagtgatgagctagagttcgcaaaaagt
tttatcggaatagtttcaatattttgtctttgtgcaaccctgttcacattccttactttc
ttaattgatgttaaaagattcagatacccagagagaccaattatctattactctgtctgt
tacagcattgtctctctgatgtactttataggattcttgctaggcaatcgcacagcctgc
aataaggcagatgagaagctagaacttggcgacacagtagttctaggatctcagaataag
gcttgtactgttctttttatgtttttgtattttttcacaatggctggcaccgtgtggtgg
gtgatacttaccattacttggttcttagctgcaggaagaaaatggagttgtgaagccatt
gaacaaaaagcggtgtggtttcatgctgttgcgtggggaataccaggttttctgactgtt
atgcttcttgctatgaacaaagttgaaggagacaacattagtggcgtttgctttgtcggc
ctatatgacctggatgcttctcgctactttgtgctcttgccattgtgcttttgtgtgttt
gttgggctgtctcttcttttagctggcattatttccttaaatcatgttcgacaagttata
caacatgatggccggaaccaagagaaactaaagaaatttatgattcgaattggagtcttt
agtggcctgtatcttgtaccattagtgacacttctcggatgttatgtctatgagcaagtg
aacaggatgacctgggagataacttgggtctctgaccactgtcgtcagtaccacatcccg
tgtccttatcaggccaaaacagaaactcgaccagaattggctttatttatgataaaatat
ctgatgacattaattgttggcatctctgcggtcttctgggttggaagcaaaaagacatgc
acggagtgggcagggttttttagacgaaatcgcaagagagatccaatcagtgaaagtcga
agagtactacaggagtcgtgtgagttcttcttaaagcacaattctaaagttaaacacaaa
aagaagcactacaaaccaagttcacacaagctgaaggtcatttccaaatccatgggaacg
agcacaggtgccacggccaatcacggcacttccgcagtagcgatcacggaccacgattac
ttaggacaagaaactttgacagaaatacaaacctccccggaaacatcagtgagggaggtg
agagcagatggagcgagcacccccagatcaagagaacaggactgtggggatcctgcttcc
ccagcagcatccagctccaaactctgtggagaacaggctgacgggaaaggccgggcaggc
aaagggaatgataagatcagtgtatctgaaagtacgcggagtgaaggaaggatgactcca
aaaagtgatgtccccgagaccggcccggtgcagagcagcggcttgcaggtcccaggttct
gcggagccaggcagcctgaaaggctccacgtccctgctcgttcactcagcttcgggaggt
ggaaaagagcaggccgctggcggtcactccgaaacttga

KEGG   Acinonyx jubatus (cheetah): 106980711
Entry
106980711         CDS       T04657                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106980711 (FZD9)
   04390 Hippo signaling pathway
    106980711 (FZD9)
   04150 mTOR signaling pathway
    106980711 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106980711 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106980711 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106980711 (FZD9)
   05205 Proteoglycans in cancer
    106980711 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106980711 (FZD9)
   05226 Gastric cancer
    106980711 (FZD9)
   05217 Basal cell carcinoma
    106980711 (FZD9)
   05224 Breast cancer
    106980711 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106980711 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    106980711 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106980711 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106980711 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    106980711 (FZD9)
   04090 CD molecules [BR:aju04090]
    106980711 (FZD9)
G protein-coupled receptors [BR:aju04030]
 Frizzled / Smoothened family
  106980711 (FZD9)
CD molecules [BR:aju04090]
 Proteins
  106980711 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 106980711
NCBI-ProteinID: XP_026897761
UniProt: A0A6J1XYY0
LinkDB
Position
Unknown
AA seq 591 aa
MAVPPLRRALLLWQLLAAGGAALEIGRFDPERGRGPAPCQAVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPA
RPPGDPASGPGGGGTCENPEKFQYVEKSRSCAPRCGSGVEVFWSRRDKDFALVWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHM
AAWGLPALKTIVILTLRKVAGDELTGLCYVASMDAAALTGFVLVPLSCYLVLGTSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRA
TEQPCLAATMPGGRRDCSLQGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CHRKMAAGRARAKACRAPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggccgtgccgccgctccgccgggcgctgctgctgtggcagctgctggcggcgggcggc
gcggcgctggagatcggccgtttcgatccggagcgcggtcgcgggccggcgccctgccag
gcggtggagatccccatgtgccgcggcatcggctacaacctgacccgcatgcccaacctg
ctgggccacacgtcgcagggtgaggcggccgccgagctggccgagttcgcgccgctcgtg
cagtacggctgccacagccacctgcgcttcttcctgtgctcgttgtacgcgcccatgtgc
acggaccaggtctcgacgcccatccccgcctgccggcccatgtgcgagcaggcgcgcctg
cgctgcgcgcccatcatggagcagttcaacttcggctggccggactcgctggactgcgcc
cggctgcccacgcgcaacgacccgcacgcgctctgcatggaggcgcccgagaacgccacg
gccggccctgcggagccccacaagggcctgggcatgctgcccgtggcgccccggcccgcg
aggccccccggcgaccccgcctccggcccgggcggcggcggcacctgcgagaacccagag
aagttccagtacgtggagaagagccgctcgtgcgcgccgcgctgcgggtccggcgtcgag
gtgttctggtcgcggcgcgacaaggacttcgcgctcgtctggatggccgtgtggtcggcg
ctgtgcttcttctccacggccttcaccgtgctcaccttcctgctggagccccaccgcttc
cagtaccccgagcgccccatcatcttcctgtccatgtgctacaacgtctactcgctggcc
ttcctcatccgcgcggtggccggcgcccagagcgtggcgtgcgaccaggaggcaggagca
ctgtacgtgatccaggaggggctggagaacacgggctgcacgctcgtcttcctgctgctg
tactacttcggcatggccagctcgctgtggtgggtggtgctgacactcacctggttcctg
gcagccggcaagaagtggggccacgaggccatcgaggcccatggcagctacttccacatg
gcggcctggggcctgccggccctcaagaccatcgttatcctgaccttgcgcaaggtggcg
ggcgacgagctgaccgggctctgctacgtggccagcatggatgcggccgcgctgacgggc
tttgtgctggttcccctctcctgctacctggtgctgggcaccagcttcctcctgaccggc
ttcgtggccctcttccacatccgcaagatcatgaagacagggggcaccaacacggagaag
ctggagaagctcatggtcaagattggggtcttctccatcctctacacggtgcctgccacc
tgcgtcattgtgtgctatgtctatgaacgcctcaacatggacttctggcgccttcgggcc
acagagcaaccctgcctggcagccaccatgcccgggggccggagggactgctcactacaa
ggggggtcggtgcccaccgtggctgtctttatgctcaagatcttcatgtcgctggtggtg
ggcatcaccagcggtgtctgggtgtggagctccaagactttccagacctggcagagcctg
tgccaccgcaagatggcagctggccgggcccgggcaaaggcctgccgggctcccgggggc
tatggccgtggcacccattgccactataaggcccccaccgtggtcttgcacatgactaag
acggacccttctctggagaaccccacgcacctctag

KEGG   Acinonyx jubatus (cheetah): 106983024
Entry
106983024         CDS       T04657                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3 isoform X1
  KO
K02329  frizzled 3
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04360  Axon guidance
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106983024 (FZD3)
   04390 Hippo signaling pathway
    106983024 (FZD3)
   04150 mTOR signaling pathway
    106983024 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106983024 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106983024 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    106983024 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106983024 (FZD3)
   05206 MicroRNAs in cancer
    106983024 (FZD3)
   05205 Proteoglycans in cancer
    106983024 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106983024 (FZD3)
   05226 Gastric cancer
    106983024 (FZD3)
   05217 Basal cell carcinoma
    106983024 (FZD3)
   05224 Breast cancer
    106983024 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106983024 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    106983024 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106983024 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106983024 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    106983024 (FZD3)
G protein-coupled receptors [BR:aju04030]
 Frizzled / Smoothened family
  106983024 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 106983024
NCBI-ProteinID: XP_026925589
UniProt: A0A6J2AAM3
LinkDB
Position
Unknown
AA seq 666 aa
MAMSWIVFYVWPLTIFVGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSELMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPSQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSTSRLTDHSRHSSSHRLNEQSRHSSIRDLSSNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggattgtcttctacgtttggcccttgactatatttgtggggcatata
ggtgggcacagtttgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcactatgaccaacagacagctgcttta
gcaatggagccattccacccaatggtgaatctggattgttctcgggattttcggccattt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcaacgggcttacagtgagtgttcggagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccatatcctcgactt
gtggatctgaatttagctggtgatcctactgaaggagctccagtggcagtgcagagggac
tatggtttttggtgtcctcgagaattgaaaattgatcctgatcttggttattctttttta
cacgtgcgtgattgttcacctccttgtccaaatatgtactttaggagagaagaactttcg
tttgctcgatacttcataggattgatttcaatcatttgcctctctgccacgttgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaagacctattatattt
tatgcagtctgctacatgatggtatcattaattttcttcattgggtttttgcttgaggac
cgagtagcctgcaatgcatctagcccttcacagtataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatggtactctatttttttactatggctggc
agtgtttggtgggtaattcttaccatcacatggttcttggcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctatttcatgccagtgcatggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatatcagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagtcggagtttctctcctcttagctggcattatatccttaaacagagtt
cgaattgaaattccattagaaaaggagaaccaagataaattggtgaagtttatgatccgg
attggtgttttcagcattctctatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgtggcatctgggaaacaacatggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacctgattctcttt
ctgatgaaatacctgatggctctcatagttggtattccctccattttttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactacaggaacctgattttgctcagtctctcctgagggatcca
aatactcctattataagaaaatcaaggggaacttccactcaaggaacatccacacatgct
tcttcaacccagcttgctatggtggatgatcagagaagcaaagcagggagtgtccacagc
aaagtaagcagctaccacggcagtctccacagatcccgtgatggcaggtatacgccctgc
agttacagaggaatggaagagaggctccctcatggcagcacatcacgactgactgatcac
tccagacacagtagttctcatcggctcaatgaacagtcacggcatagcagcatcagagat
ctcagtagtaatcctatgactcacatcacacatggtaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

KEGG   Acinonyx jubatus (cheetah): 106986936
Entry
106986936         CDS       T04657                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106986936 (FZD10)
   04390 Hippo signaling pathway
    106986936 (FZD10)
   04150 mTOR signaling pathway
    106986936 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106986936 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106986936 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106986936 (FZD10)
   05205 Proteoglycans in cancer
    106986936 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106986936 (FZD10)
   05226 Gastric cancer
    106986936 (FZD10)
   05217 Basal cell carcinoma
    106986936 (FZD10)
   05224 Breast cancer
    106986936 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106986936 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    106986936 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106986936 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106986936 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    106986936 (FZD10)
   04090 CD molecules [BR:aju04090]
    106986936 (FZD10)
G protein-coupled receptors [BR:aju04030]
 Frizzled / Smoothened family
  106986936 (FZD10)
CD molecules [BR:aju04090]
 Proteins
  106986936 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 106986936
NCBI-ProteinID: XP_026899678
UniProt: A0A6J1Y4L5
LinkDB
Position
Unknown
AA seq 640 aa
MPRPGPRLWLVLQVMGSCAAISSMDTERPGDGKCQAIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCSRLPNKNDPNYLCMEAPNNGSDEPSRGSGLFPPLFRPQRPHSAQEH
PLRDAGPGRASCDNPGKFHHVEKSAACAPLCAPGVDVYWSRGDKRFAVVWLAVWAVLCFF
SSAFTVLTFLVDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVVGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMEYWKVLATQHT
CKTNNQTKSLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNICSRRFK
TKSRRKPASVITNSGIYKKGQHPQKTHLGKYEIPDQPPTCTSVPGKTKFRGTGMRFGVDT
DRRSRLLTTSSAPAPGKRGTVAPRSRPGAGDQYAMKVARE
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgccgcggccgggcccccgcctgtggctggtcctgcaggtgatgggttcgtgcgccgcc
atcagctccatggacacggagcgcccgggcgacggcaagtgccaggccatcgagatcccg
atgtgcaaggacatcggctacaacatgacccgcatgcccaacctgatgggccacgagaac
cagcgcgaggcagccatccagctgcacgagttcgcgccgctggtggagtacggttgccac
ggccacctccgcttcttcctgtgctcgctgtacgcgcccatgtgcaccgagcaagtctcc
acccccatccccgcctgccgggtcatgtgcgagcaggcccggctcaagtgctccccgatc
atggagcagttcaacttcaagtggcccgactcgctggactgcagcaggctccccaacaag
aacgaccccaactacctgtgcatggaggcgcccaacaacggctcggacgagccctcccgg
ggctccggcctgttcccgccgctcttccggccgcagcggccgcacagcgcgcaggagcac
ccgctccgggacgcgggcccggggcgcgccagctgtgacaacccgggcaagttccaccac
gtggagaagagcgccgcgtgcgcgccgctgtgcgcgcccggcgtggacgtgtactggagc
cgcggcgacaagcgcttcgccgtggtctggctggccgtgtgggccgtgctgtgcttcttc
tccagcgccttcaccgtgctcaccttcctcgtcgacccggcgcgcttccggtaccccgag
cgccccatcatcttcctctccatgtgctactgcgtctactccgtgggctacctcatccgc
ctctttgccggcgccgagagcatcgcctgcgaccgcgacagcggacagctctacgtcatc
caggaggggctggagagcaccggctgcaccctcgtcttcctggtcctctactactttggg
atggccagctcgctgtggtgggtgattctcacgctcacctggttcctggcggcgggcaag
aagtggggccacgaggccatcgaagccaacagcagctacttccacctggcggcctgggcc
atcccggccgtgaagaccatcctgatcctggtgatgcgccgggtggcgggggacgagctc
accggcgtgtgctacgtgggcagcatggacgtgaacgccctcaccggcttcgtgctcatc
ccgctggcctgctacctcgtggtgggcacttccttcattctgtccggcttcgtggcgctc
ttccacatcaggagggtgatgaagaccggcggggagaacacggacaaactggagaagctc
atggtgagaatcggggtcttctcggtgctctacacggtgccggccacctgtgtgatcgcc
tgttacttctacgagcgcctcaacatggaatactggaaggtcctggccacccagcacacg
tgcaaaacgaacaaccagaccaagagtctggactgtctgatggccgcctccatccccgcc
gtggagatcttcatggtgaagattttcatgctgctggtggtggggatcaccagcggcatg
tggatctggacgtccaagaccctgcagtcctggcagaacatttgcagccgcaggttcaag
acaaagagcaggaggaaaccggccagcgtgatcaccaacagtgggatttacaaaaagggc
cagcatccccaaaagacgcatctggggaaatatgaaatccctgaccagcctcccacctgt
acctcagtccccgggaaaactaagttccgcggcactggcatgcgtttcggcgtggatacc
gaccgcaggagtcgtctcctcaccacctcctccgcgccagcgcccgggaaacggggcacc
gtggctccgaggtcgcggcccggtgcaggagaccagtacgccatgaaagtggctcgtgag
tga

KEGG   Acinonyx jubatus (cheetah): 106987276
Entry
106987276         CDS       T04657                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106987276 (FZD1)
   04390 Hippo signaling pathway
    106987276 (FZD1)
   04150 mTOR signaling pathway
    106987276 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106987276 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106987276 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106987276 (FZD1)
   05205 Proteoglycans in cancer
    106987276 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106987276 (FZD1)
   05226 Gastric cancer
    106987276 (FZD1)
   05217 Basal cell carcinoma
    106987276 (FZD1)
   05224 Breast cancer
    106987276 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106987276 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    106987276 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106987276 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106987276 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    106987276 (FZD1)
G protein-coupled receptors [BR:aju04030]
 Frizzled / Smoothened family
  106987276 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 106987276
NCBI-ProteinID: XP_026927662
UniProt: A0A6J2ACK2
LinkDB
Position
Unknown
AA seq 653 aa
MAEEEAPKKSWAAAAGGGASWELYAGALPAGPVAEGSGDAESRRRRRPPADSGRLARRLL
LLLWLLEIPLLLGVRAQAVGQGPGQGPGPGQQPPPPPPQQQQGGQQYNGERGISIPDHGY
CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAP
VCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDK
GTPTPSLLPEFWTSNPQHGGGGHRGGGFPGGSGASERGKFSCPRALKVPSYLNYHFLGEK
DCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERP
IIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFSEDGARTVAQGTKKEGCTILFMMLYFFSM
ASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLS
GVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLM
VRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHP
PMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1962 nt   +upstreamnt  +downstreamnt
atggctgaagaggaggcgcctaagaagtcctgggccgccgccgccggcggcggcgcgagc
tgggaactttatgccggggcgctcccagctggaccggtggcggaagggagcggagatgcg
gagagccgccgccgccgccgccccccagctgactccgggcgcttggcgcgccggctcctg
ctactgctttggctgctggagattccgctgctgctgggggtccgggcgcaggcagtgggc
caggggccgggccaggggcccgggccggggcagcagcccccaccgccgccgcctcagcag
cagcagggcgggcaacagtacaacggcgagcggggcatctctatcccggaccacggctac
tgccagcccatctccatcccgctgtgcacagacatcgcgtacaaccagaccatcatgccc
aaccttttgggccacacgaaccaagaggatgcgggcctcgaggtgcaccagttctacccc
ttggtgaaggtgcagtgctcggcggaactcaagttcttcttgtgctctatgtacgcgcca
gtgtgcacggtgctggagcaggctctgccgccctgccgctccctgtgcgagcgtgcgcgc
cagggctgcgaggcgctcatgaacaagttcggcttccagtggcctgacacgctcaagtgt
gagaagttcccggtgcacggcgccggcgagctgtgcgtgggccaaaatacgtcggacaag
ggcaccccgacgccctcgttgctcccggagttctggaccagcaaccctcagcacggcggc
ggggggcaccgtggcggcggcttcccggggggctccggcgcgtcggagcgtggcaagttc
tcttgcccgcgcgccctcaaggtgccctcctacctcaactaccacttcctgggggagaag
gactgcggtgcgccctgtgagccgaccaaggtgtacgggcttatgtactttgggcccgag
gagctgcgcttctcgcgcacctggatcggcatctggtcggtgctgtgctgcgcctccacg
cttttcacggtgctaacgtacctggtggacatgcggcgcttcagctacccagagcggccc
atcatcttcctgtccggctgctacacggcagtggccgtggcctacatcgccggcttcctg
ctggaggaccgagtggtgtgtaacgacaagttctccgaggacggggcacgcacagtggcg
cagggcaccaagaaggagggctgcaccatcctcttcatgatgctttacttcttcagcatg
gccagctccatctggtgggtgatcctgtcgctcacctggttcctggcagcgggcatgaag
tggggtcacgaagccatcgaggctaactcgcaatattttcacctggccgcctgggccgtt
ccggccatcaagaccatcaccatcctggcgctgggccaggtggacggcgatgtgctgagc
ggggtgtgcttcgtagggctcaacaatgtggacgcgctgcgcggcttcgtgctggcgcca
ctcttcgtgtacctgttcatcggcacgtcttttttgttggccggcttcgtgtccctcttc
cgcattcgcaccatcatgaagcacgacggcaccaagaccgagaagctggagaagctcatg
gtgcgcatcggcgttttcagcgtgctttacacggtgccagccactattgtcatcgcctgc
tacttctatgagcaggccttccgggaccagtgggagcgcagctgggtggcccagagctgc
aagagctacgccatcccctgcccccacctccaggcgggtggaggcgccccgccgcacccg
cccatgagcccagacttcacagtcttcatgatcaagtaccttatgacgctgatcgtgggc
atcacgtcaggcttctggatctggtccggcaagaccctcaactcctggaggaagttctat
actaggctcaccaacagcaaacagggggagaccaccgtctga

KEGG   Acinonyx jubatus (cheetah): 113603657
Entry
113603657         CDS       T04657                                 

Gene name
FZD8
Definition
(RefSeq) frizzled-8 isoform X1
  KO
K02375  frizzled 5/8
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113603657 (FZD8)
   04390 Hippo signaling pathway
    113603657 (FZD8)
   04150 mTOR signaling pathway
    113603657 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113603657 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    113603657 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113603657 (FZD8)
   05205 Proteoglycans in cancer
    113603657 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113603657 (FZD8)
   05226 Gastric cancer
    113603657 (FZD8)
   05217 Basal cell carcinoma
    113603657 (FZD8)
   05224 Breast cancer
    113603657 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113603657 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    113603657 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113603657 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113603657 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    113603657 (FZD8)
G protein-coupled receptors [BR:aju04030]
 Frizzled / Smoothened family
  113603657 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2
Other DBs
NCBI-GeneID: 113603657
NCBI-ProteinID: XP_026929639
UniProt: A0A6J2AM79
LinkDB
Position
Unknown
AA seq 643 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPNPPRRLPPPPPGEQPPSGS
GHGRPPGARPPSRGRGGGGVDAAAPPTRGGGGGKARPPGGGSAPCEPGCQCRAPMVSVSS
ERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDM
ERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKQHVRYETTGPALCTVVFLLVYFFGMA
SSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAG
ICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKL
MIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLK
YFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGASGGAGAGAAGGGGVPGGGGGVG
SGGGGVPGGGAGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctctttgctggccgccttggcgctgttgcag
cgctcgagcggtgcggcggctgcctcggctaaggagctggcttgccaagagatcaccgtg
ccgctgtgcaagggcatcggctacaactacacgtacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggccttgaggtgcaccagttctggccgctagtagagatccagtgc
tcgcccgacctcaagttcttcctgtgcagcatgtacacgcccatctgcctggaggactac
aagaagcccctgcctccttgccgctcggtctgcgagcgcgccaaggccggctgcgcaccc
ctcatgcgccagtacggcttcgcctggcccgaccgcatgcgctgcgaccggctgccggag
cagggcaaccccgacacgctgtgcatggactacaaccgcaccgacctcaccacagccgca
cccaatccgccgcgccgcctgccgccgccgcccccgggtgagcagccgccctccggcagt
ggccacggccgcccgcccggggccaggcccccgtcccgcggcaggggcggtggcggcgtg
gacgcagcggcgccccccacgcgcggcggcggcggcgggaaggcgcggccccctggcggc
ggctccgctccctgcgagccgggctgccagtgccgcgcgcccatggtgagcgtgtccagc
gagcggcatcccctctacaaccgcgtcaagaccggccagattgccaactgcgcgctgccc
tgccacaaccccttcttcagccaggacgaacgcgccttcaccgtcttctggatcggcctg
tggtctgtgctgtgcttcgtgtccaccttcgccaccgtctccaccttcctcatcgacatg
gagcgcttcaagtatcctgagcggcccattatcttcctgtcggcctgctacctcttcgtg
tctgtcggctacctggtacgcctggtggcgggccacgagaagcagcacgtgcgctacgag
accacgggcccggcgctgtgcaccgtggtcttcttgctcgtctacttcttcggcatggcc
agctccatctggtgggtgatcctgtcgctcacgtggttcctggcggcgggcatgaaatgg
ggcaatgaggccatcgctggctactcgcagtacttccacctggccgcgtggctcgtgccc
agcgtcaagtctatcgccgtcctggcgctcagctccgtggacggcgacccggtggccggc
atctgctacgtgggcaaccagagcctcgacaacctgcgcggcttcgtcctagcgccgctc
gtcatctacctcttcatcggcaccatgttcctgctggccggcttcgtgtcgctcttccgc
atccgctcagtcatcaagcagcagggcggccccaccaagacgcacaaactggagaagctc
atgatccgcctgggtctcttcaccgtactctacaccgtgcccgcagccgtcgtggtcgcc
tgcctcttctatgagcagcacaaccgcccgcgctgggaggccacgcacaactgcccgtgt
ctgcgggacctgcagccagaccaagcgcgccggcccgactacgccgtcttcatgctcaag
tacttcatgtgcctcgtggtgggcatcacctcgggcgtgtgggtctggtccggcaagact
ctcgagtcgtggcgcgccctgtgcacccgctgctgctgggccagcaagggtgcttcgggg
ggcgcgggcgctggggccgcaggggggggtggggtgccgggaggtggtgggggcgtgggg
tccggtgggggcggggtcccgggcggtggggcgggatccctctacagcgacgtcagcacc
ggcctgacgtggcgatctggcacggccagctccgtgtcttatccaaagcaaatgccattg
tcccaggtctga

DBGET integrated database retrieval system