KEGG   Acinonyx jubatus (cheetah): 106967115
Entry
106967115         CDS       T04657                                 

Gene name
NR3C1
Definition
(RefSeq) LOW QUALITY PROTEIN: glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106967115 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106967115 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:aju03310]
    106967115 (NR3C1)
Transcription factors [BR:aju03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    106967115 (NR3C1)
Nuclear receptors [BR:aju03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   106967115 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 106967115
NCBI-ProteinID: XP_026898332
UniProt: A0A6J1Y0A5
LinkDB
Position
Unknown
AA seq 780 aa
MDSKESLTPPSKEEISSSVLGRERGNVMDFYKTLRGGASVKVSASSPSLAAVSQSDSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNELGFPQQGQISLSSGETDF
QLLEESIANLNRSTSVPENPKSSATVAVAAAPTEEFPKTLSDVSSEQQNLKGQTGTNGGN
VKLYTTDQSTFDIWRKKLQDLEFSSGSPDKETSESPWRSDLLIDENCLLSPLAGEDDPFL
LEGNSNEDCKPLVLPDTKPKIKDNGDLILSSPNSVSLPQVKTEKEDFIELCTPGVIKQEK
LGPVYCQASFSGANIIGNKVSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPP
IPVGSENWNRCQASGDDNLASLGTLNFPGRSVFSNGYSSPGMRPDVSSPPSSSAAATGPP
PKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR
YRKCLQAGMNLEARKTKKKIKGIQQATPGVSQETSENPANKTVVPATLPQLTPTLVSLLE
VIEPEVLYAGYDSSMPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQ
YSWMFLMAFALGWRSYRQSSANMLCFAPDLVINEHRMTLPCMYEQCKHMLYVSSELHRLQ
VSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQ
LTKLLDSMHDVVENLLNFCFQTFLNKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQK
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggactccaaggaatcattaaccccccccagtaaagaagaaatctctagcagtgtgctt
ggtcgggagaggggaaatgtgatggacttctataaaaccctaaggggaggagcttctgtg
aaggtttctgcatcttcaccgtcactggctgctgtttctcagtcagactccaagcaacaa
agacttttggtggattttccaaaaggctcaggaagcaatgcacagcagccggatctgtcc
aaggcagtttcgctgtcaatgggactgtatatgggagagacagaaacaaaagtaatggga
aatgagctgggattcccacagcagggccaaatcagcctttcctctggggaaacagacttt
cagcttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttcccgagaacccc
aagagctcagcgaccgttgctgttgctgctgcccccacagaggagtttccaaaaacactc
tctgatgtctcttcagaacagcaaaatttgaagggccaaactggcaccaacgggggcaat
gtgaagttgtataccacagaccaaagcacctttgacatttggaggaaaaaactccaggat
ttggaattttcttctgggtccccagataaagagacaagtgagagtccttggagatcagac
ctcttgatagatgaaaactgtttgctttctcctttggcaggagaggatgatccattcctt
ttggaagggaactcgaatgaggactgtaagcctctcgttttaccggacactaaacctaaa
attaaggataatggagatctgatcttatcaagccccaacagtgtgtcactgccccaagtg
aaaacagaaaaagaagatttcattgaactctgcacccctggggtaattaagcaggagaaa
ctgggcccagtttattgtcaggcaagcttttctggggcaaatataattggtaataaagtg
tctgccatttctgttcatggcgtgagtacctctgggggccagatgtaccactatgacatg
aatacagcatccctttcgcaacaacaggatcagaagcctattttcaatgtcattccacca
attcctgttggttcagaaaattggaataggtgtcaagcatctggagatgacaacttggct
tccttggggactttgaacttccctggccgatcggtgttttctaatggctattcaagccct
ggaatgagaccagatgtaagctctcctccatccagctctgcagcggcaacgggaccacct
cccaaactctgccttgtgtgctctgatgaagcttcggggtgtcactacggggtcttgact
tgtggaagctgtaaagtattcttcaaaagagcagtggaaggacagcacaattatctttgt
gctggaagaaatgattgtatcattgataagattcgaagaaaaaactgtccagcatgccgc
tatcgaaaatgtcttcaggctggaatgaacctggaagctcgaaaaacaaagaaaaagata
aaaggaattcagcaggccaccccaggagtgtcccaagaaacttctgaaaaccctgctaac
aaaacggtagttcctgcaacattaccacagctcacccctaccctggtgtccctgctggag
gtcatcgaacccgaggtgttatacgcagggtatgatagctcaatgccagattcgacttgg
cggatcatgaccacactcaacatgttaggcgggaggcaagtgattgcagcagtgaaatgg
gccaaggcgataccaggattcaggaacttacacctggatgaccaaatgaccctactgcaa
tattcatggatgttcctcatggcatttgccctggggtggagatcatatagacaatcaagt
gcaaacatgctgtgttttgctcctgatctggttattaatgagcatagaatgactctaccc
tgcatgtatgaacaatgtaaacatatgctgtatgtttcctctgagttacacaggcttcag
gtatcttatgaagagtatctctgtatgaaaaccttactgcttctctcttcagttcctaag
gaaggtttgaagagccaagagctatttgatgaaattagaatgacctacatcaaagagcta
ggaaaagccattgtcaagagggaaggaaactccagtcagaactggcagcggttttatcaa
ctgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaacttttgcttc
caaacatttttgaataagaccatgagtattgaattcccagagatgttagctgaaatcatc
accaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaaaag
tga

DBGET integrated database retrieval system