KEGG   Acinonyx jubatus (cheetah): 106967134
Entry
106967134         CDS       T04657                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04014  Ras signaling pathway
aju04015  Rap1 signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04390  Hippo signaling pathway
aju04810  Regulation of actin cytoskeleton
aju05200  Pathways in cancer
aju05218  Melanoma
aju05224  Breast cancer
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106967134 (FGF1)
   04014 Ras signaling pathway
    106967134 (FGF1)
   04015 Rap1 signaling pathway
    106967134 (FGF1)
   04390 Hippo signaling pathway
    106967134 (FGF1)
   04151 PI3K-Akt signaling pathway
    106967134 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106967134 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106967134 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    106967134 (FGF1)
   05218 Melanoma
    106967134 (FGF1)
   05224 Breast cancer
    106967134 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aju04052]
    106967134 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106967134 (FGF1)
Cytokines and growth factors [BR:aju04052]
 Growth factors
  Growth factors (RTK binding)
   106967134 (FGF1)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   106967134 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 106967134
NCBI-ProteinID: XP_014918843
UniProt: A0A6I9ZHX5
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacaaccttcacggccctgacggagaagttcaatctgcctcca
gggaattacaagaaacccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggatgggacgagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttgtacggctcacagacaccaaatgaggaatgcttgttc
ctggaaaggctggaagaaaaccattacaatacctacacatccaagaagcacgcagaaaag
aattggtttgtgggtctcaagaagaatggaagctgcaaacgcggtccccggactcactat
ggccagaaggcaattttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system