KEGG   Acinonyx jubatus (cheetah): 106967151Help
Entry
106967151         CDS       T04657                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00010  Glycolysis / Gluconeogenesis
aju00051  Fructose and mannose metabolism
aju00052  Galactose metabolism
aju00500  Starch and sucrose metabolism
aju00520  Amino sugar and nucleotide sugar metabolism
aju00524  Neomycin, kanamycin and gentamicin biosynthesis
aju01100  Metabolic pathways
aju01200  Carbon metabolism
aju04066  HIF-1 signaling pathway
aju04910  Insulin signaling pathway
aju04930  Type II diabetes mellitus
aju04973  Carbohydrate digestion and absorption
aju05230  Central carbon metabolism in cancer
Module
aju_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aju_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106967151 (HK1)
   00051 Fructose and mannose metabolism
    106967151 (HK1)
   00052 Galactose metabolism
    106967151 (HK1)
   00500 Starch and sucrose metabolism
    106967151 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    106967151 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106967151 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    106967151 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106967151 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    106967151 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    106967151 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    106967151 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aju04131]
    106967151 (HK1)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106967151 (HK1)
Membrane trafficking [BR:aju04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106967151 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 106967151
NCBI-ProteinID: XP_014918857
LinkDB All DBs
Position
Un
AA seq 922 aa AA seqDB search
MGQSCQRGCSEEASEKPIKPPLTEVKIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRDF
NPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQNVHMESEIYDTP
ENIVHGSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAILITWTKKF
KASGVEGMDVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTN
ACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEK
MVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFKTSDVSAIEKNKEGLHNAKEI
LTRLGVEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGS
LYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLA
HFRLTKDMLLEVKKRMRAEMDMGLRKQTHEKAVVKMLPSFVRSTPDGTEHGDFLALDLGG
TNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPR
MPLGFTFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAVV
NDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGDEGRMCINMEWGAFGDN
GCLDDIRTLYDRLVDEYSLNAGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEP
LKTRGIFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCG
AGMAAVVDKIRENRGLDHLSVTVGVDGTLYKLHPHFSRIMHQTVQELSPNCNVSFLLSED
GSGKGAALITAVGVRLREESSS
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggggcagagctgccagcgaggatgcagtgaagaagcatctgaaaagcccatcaagccc
ccacttactgaagttaagattgacaagtatctctatgccatgcggctctccgatgaaact
ctgatagatatcatgactcggttcaagaaggagatgaagaatggcctctcccgggatttt
aatccaacagccacagtgaagatgttgccaacgtttgtaaggtctattcctgatggttca
gaaaagggagatttcattgccctggatcttggcgggtcttcctttcgaattctgagggtg
caagtgaatcatgagcaaaaccagaatgttcacatggagtccgagatttatgacaccccg
gagaacatcgtgcacggcagtggaagccagcttttcgatcacgtcgccgagtgcctggga
gacttcatggagaagaagaaaatcaaggacaagaaattacctgtgggattcacgttttcc
ttcccttgtcggcagtccaaaatagatgaggccatcctgatcacctggacaaagaaattt
aaagcgagcggagtagagggaatggatgtggtgaagctgcttaacaaagccatcaaaaag
cgcggggactacgatgccaacattgtggctgtggtgaacgacacggtggggaccatgatg
acctgtggctacgacgaccagcagtgcgaagtcggcctcatcattggcactggcaccaac
gcgtgctacatggaggaactgaggcacattgacctggtggaaggcgacgagggcaggatg
tgcatcaacacggagtggggggcctttggggacgacgggtccctcgaagacatccgcacc
gagttcgaccgggagatagaccgtggctctctcaaccctgggaagcagctgtttgagaag
atggtgagtggcatgtacttgggggagctggttcgactgatcctggtcaagatggccaag
gagggcctcttatttgaaggacggatcaccccggagctgctcaccagggggaagttcaag
accagtgatgtgtcagccattgaaaagaataaggaaggcctccacaatgccaaagaaatc
ctgacccgcctgggagtggagccatctgatgacgactgtatttcagtccagcacgtgtgt
accattgtctcatttcgctctgccaacctggtggctgcaacgctgggcgccatcttgaac
cgccttcgagataacaagggcacacccaggctgcggaccacggttggtgtcgacgggtct
ctttacaagacgcacccacagtattcacgacgtttccacaagactctgaggcgcttggtg
cctgactccgatgtgcgcttcctcctctcggagagcggcagcgggaagggagccgccatg
gtcaccgcggtggcctaccgcctggccgagcagcaccggcagatcgaggagaccctggcc
cacttccgcctcaccaaggatatgctgctggaggtgaagaagagaatgcgggccgagatg
gacatgggcctgaggaaacagacgcatgaaaaggccgtagtcaagatgctgccctccttc
gtccggagcactccagacgggaccgagcatggtgacttcttggcccttgatcttggagga
acgaatttccgtgtcttactggtgaaaatccgcagtgggaaaaagagaacggtggaaatg
cacaacaagatctatgccattcccattgaaatcatgcagggcactggggaagagctgttt
gaccacatcgtctcctgcatctccgacttcctggactacatggggatcaaaggccccaga
atgcctctcggcttcacgttctcattcccctgcaagcagacgagcttggatgcgggaatc
ttgatcacctggacgaagggttttaaggcaaccgactgcgtggggcacgatgtagcaacc
ttactaagggatgcgatcaaaaggagagaggaatttgacctggacgtggtggctgtggtc
aatgacacggtgggcaccatgatgacctgtgcttatgaagagcctacctgcgaggttgga
ctcatcgtagggactggcagcaacgcctgctacatggaagaaatgaagaatgtcgagatg
ctggagggggacgaggggcgaatgtgcatcaacatggagtggggtgcctttggggacaat
gggtgtctcgatgacatcagaactctctatgacagactggtggatgaatattctctaaac
gctggaaaacaaaggtttgagaagatgatcagcggtatgtacctgggtgagatcgtccgc
aacatcttgatcgacttcaccaagaaggggttcctcttccgagggcagatctctgagccg
ctgaagactcgtggcatttttcagaccaaatatctctcccagattgagagtgaccggtta
gcactgctccaggtccgggccatcctccagcagctgggcctgaatagcacctgtgacgac
agtatcctcgtcaagaccgtgtgcggggtggtgtccaaacgggccgcgcagctgtgcggt
gcgggcatggccgccgtggtggacaagatccgcgagaacagagggctggaccatctcagt
gtgactgtgggggtggatggaacactctacaagcttcatccgcacttctcgagaatcatg
caccaaaccgtgcaggaactgtcaccgaactgcaacgtgtccttcctcctgtccgaagac
ggcagtggcaagggggctgccctcatcacggccgtgggcgtccggctccgggaagaatcg
agcagctaa

DBGET integrated database retrieval system