KEGG   Acinonyx jubatus (cheetah): 106967186
Entry
106967186         CDS       T04657                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin alpha-3
  KO
K05691  catenin alpha
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04670  Leukocyte transendothelial migration
aju05100  Bacterial invasion of epithelial cells
aju05200  Pathways in cancer
aju05213  Endometrial cancer
aju05226  Gastric cancer
aju05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    106967186 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106967186 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    106967186 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106967186 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    106967186 (CTNNA3)
   05213 Endometrial cancer
    106967186 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106967186 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    106967186 (CTNNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aju04812]
    106967186 (CTNNA3)
Cytoskeleton proteins [BR:aju04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     106967186 (CTNNA3)
SSDB
Motif
Pfam: Vinculin AAA_32 EF-G-binding_N
Other DBs
NCBI-GeneID: 106967186
NCBI-ProteinID: XP_026917902
UniProt: A0A6J1ZK76
LinkDB
Position
Unknown
AA seq 895 aa
MSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSNRKKGCSKRARVLLA
SVEEATWNLLDKGEKIAQEATVLKEELTTVLEEVRKESEALKVSAERFADDPCYLPKREA
VVQAARALLAAVTRLLILADMIDVMCLLQHVSAFQRTFESLKNVSNKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICSACLEHSDVASLKASKDT
VCEEIHNALNVISNASQGIQNTIAPPESKAATLGSALDELENLIILDPLTVTEEEIRPSL
EKRLEAIISGAALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNTGKKERSNTLN
IAIDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYASIFRE
HTSRLIEVANLACSMSTNEDGIKIVKVAANHLETLCPQIINAALALAARPKSQVVKKNME
MYKHTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARLAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTAIPEFVTQVNVALEALSKNSLDV
FDDDQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTEGKTDRA
KMTQLPESEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPTG
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPVQVMSEFRGRHVY
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgtcagctgaaacaccaatcacactgaatattgatcctcaggatctgcaggtccaaaca
ttcactgtagagaagctactggaacctctcataatccaggttactacacttgtaaattgt
ccccagaatccttctaacaggaaaaaaggatgttcaaaaagagccagagtccttctagct
tctgtggaggaagcaacttggaatttattagacaagggagagaagattgcccaggaagcc
acagttttaaaggaagagcttactactgtacttgaggaagttcgcaaagaaagtgaagct
ctgaaagtatcagctgagagatttgcagatgacccctgttatctcccaaaaagggaggct
gtggttcaggctgcccgtgccttgttggctgcagttaccagactccttatcctcgcagac
atgattgatgtcatgtgtctcttacagcacgtgtcagcttttcaaagaacatttgagtct
cttaaaaacgtttccaataaatctgacctccagaaaacctaccagaagcttgggaaggag
ctggaaaatctggattatttagccttcaaacgtcagcaggacttaaaatctccaaatcag
agggatgaaattgcaggggcccgggcctctctgaaggaaaactccccgctcttgcattca
atttgttcagcttgtttggaacattctgatgttgcttcccttaaagccagcaaggacaca
gtttgtgaagaaattcacaatgccctcaatgtaatttcaaatgcttcacaaggcatccag
aatacgattgccccaccggaatctaaggcagccaccctgggaagtgcccttgatgagctt
gagaatttaattatcttggatccactcacagtgactgaggaagaaataagaccatcacta
gaaaaacgtcttgaagccattatcagtggggctgcactgttggctgactcttcctgcaca
agagatttccatcgggaacggattatcgcagaatgcaatgccattcgtcaggctctccag
gacctgctttcagagtacatgaacaatactggaaaaaaggaaaggagtaataccctgaat
attgcaatagacaatatgtgcaagaagacaagagaccttcgcagacagctccgtaaggct
attatagatcatgtgtcagactcctttttggatacaacggtcccacttttggttctcatt
gaagctgccaagaatggccgggaaaaggaaataaaagaatatgcttcgatatttcgtgag
cacaccagcaggcttatagaggtggcaaatcttgcttgttccatgtcaacaaatgaagat
gggattaaaattgttaaagttgcggccaatcacctggaaaccttgtgtccacagatcatt
aatgctgcacttgctttggctgcaagacccaaaagtcaagtggtcaaaaaaaacatggaa
atgtacaagcacacatgggagaatcatatccacgtcctcaccgaagctgtagatgacatc
acaagcattgatgacttcctcgctgtatctgagagccatatcctagaagatgtcaacaaa
tgtatcatagccttgagagaccaggatgctgataacttagaccgtgctgcaggtgccatc
agaggacgggcagcaagacttgctcatattgtcacaggtgaaatggacagttatgagcca
ggagcttacactgaaggtgtgatgagaaatgttaacttccttacaagtactgcaattcct
gagtttgtaacacaagtgaatgttgccttggaagccttaagtaaaaactctttggatgta
tttgatgatgatcaatttgtggacatctcaaagaagatctatgatacaatccacgatatc
agatgttcagtcatgatgattcggaccccagaggaactggaggatgtttctgacttggaa
gaggaacatgaggtgcgcagtcacaccagcattcagactgaagggaaaactgaccgggct
aagatgactcagttgcctgagtcagaaaaggaaaagattgctgagcaagttgctgatttc
aagaaagtaaagagtaaactggatgctgagattgaaatatgggatgatacaagcaatgat
atcattgttctggctaagaagatgtgtatgattatgatggagatgacagacttcacaagg
ggcaaaggaccactaaaacatacaactgatgtgatttatgccgctaaaatgatatcagaa
tcgggatcaaggatggatgtccttgctcggcagattgccaaccagtgtccagatccatca
tgcaaacaagatttgttggcctacttggaacagattaagttttactctcaccaactgaaa
atctgcagtcaagttaaagctgagatccagaacttaggaggagagctcatcatgtcagct
ttggacagcgtcacctccctgatccaagcggccaaaaatttaatgaatgctgtagtgcaa
acagtgaaaatgtcttacattgcctcaaccaagatcatccgaattcagagtcctactggg
cctcggcacccagttgtgatgtggagaatgaaggctcctgcaaaaaagcccttgattaaa
agagagaagccagaggaaacttgtgcagctgtcagacgaggctcagcaaagaaaaaaatc
cacccagtgcaagtcatgagtgaatttagaggaagacatgtctactga

KEGG   Acinonyx jubatus (cheetah): 106967933
Entry
106967933         CDS       T04657                                 

Gene name
CTNNA1
Definition
(RefSeq) catenin alpha-1
  KO
K05691  catenin alpha
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04670  Leukocyte transendothelial migration
aju05100  Bacterial invasion of epithelial cells
aju05200  Pathways in cancer
aju05213  Endometrial cancer
aju05226  Gastric cancer
aju05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    106967933 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106967933 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    106967933 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106967933 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    106967933 (CTNNA1)
   05213 Endometrial cancer
    106967933 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106967933 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    106967933 (CTNNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aju04812]
    106967933 (CTNNA1)
Cytoskeleton proteins [BR:aju04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     106967933 (CTNNA1)
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 106967933
NCBI-ProteinID: XP_026932382
UniProt: A0A6J2AQT1
LinkDB
Position
Unknown
AA seq 906 aa
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKTAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGTEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgactgctgtccatgcaggcaacataaacttcaaatgggaccccaaaagtctagagatc
aggactctggcagttgagagactgttggagcctcttgttacacaggttacaactctggta
aacaccaatagtaaagggccctcgaataagaagagaggccgttctaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaattttttggagaagggggataaaattgca
aaggagagtcaatttctcaaggaggagcttgtggctgctgtagaagatgttcgaaaacaa
ggtgatttgatgaagactgctgcgggagagtttgcagatgatccctgctcttctgtgaag
cgtggcaacatggttcgggcagctcgagctttgctctctgctgttacccggctgcttatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtggaagatggt
atcttgaaactgaggaatgctggcactgaacaagacttaggaatacagtataaagccctg
aaacctgaagtggataagctgaacattatggcagccaaaaggcaacaggaactgaaagat
gtgggccatcgtgatcagatggctgcagccagaggaatcctgcagaaaaatgttccgatc
ctctatactgcgtcccaggcatgcctccagcaccctgatgttgcagcctataaggctaac
agagacctgatatataagcagctgcagcaggcggtcacaggcatttccaatgcagcccag
gccactgcatcagacgatgcttcccagcaccagggtggaggaggaggagaactggcttat
gcgctcaataactttgataaacaaatcattgtggatcccttgagcttcagtgaggagcgc
tttaggccttccctggaggagcgcctagagagcatcatcagtggggctgccctgatggct
gactcgtcttgcacgcgtgatgaccggcgtgagagaattgtggcagagtgtaatgctgtc
cgccaggccctgcaggacttgctctcagagtacatgggtaatgctggacgtaaagaaaga
agtgatgcactcaattctgccatagataaaatgactaagaagactagagacttgcgtaga
cagctacgcaaagccgtcatggaccatgtttcagattcattcctggaaaccaacgttcca
cttttagtattgattgaagctgcaaagaatggaaatgagaaagaagttaaggaatatgct
caagttttccgtgaacatgccaacaaattgattgaggttgccaacttggcctgttccatc
tcaaacaatgaagaaggtgtaaagcttgttcgaatgtcagcaagtcagctagaagctctc
tgtcctcaggttatcaatgctgcattggctttagcagcaaaaccacagagtaaactggcc
caagagaacatggatctttttaaagaacagtgggaaaaacaagtccgtgttctcacagat
gctgtcgatgacattacttccattgatgacttcttggctgtctcagagaatcacattttg
gaagatgtgaacaaatgtgtcattgctctccaagagaaagatgtggatgggctggaccgc
acagctggtgcgattcgaggccgggctgctagggtcatccatgtagtcacatcagagatg
gacaactatgagccaggggtctacacagagaaggtcctggaagccaccaagctgctctcc
aacacagtcatgccacgttttactgagcaagtagaggcagctgtggaagccctcagctcg
gaccctgcccagcccatggatgagaatgagtttattgatgcctcccgcctagtgtacgat
ggcatccgggacatcaggaaagcggtgttgatgataaggacccctgaggaactggatgat
tctgacttcgagacagaagactttgatgtcagaagtaggacaagtgtccagacagaagat
gatcaactgattgctggccagagtgcccgggcgatcatggctcagcttccccaggagcaa
aaagcaaagattgcagaacaggtggccagcttccaggaagaaaagagcaagctggatgct
gaagtgtccaaatgggacgacagtggtaatgacatcatcgtgctggccaagcagatgtgc
atgatcatgatggagatgaccgacttcacccgaggtaaaggacctctcaaaaatacatcg
gatgtgatcagtgccgccaagaaaattgctgaggcgggatccaggatggataagctcggc
agaaccattgcagaccactgccccgactcagcctgcaagcaggacttgctggcctacctg
cagcgtatcgccctctactgccaccagctcaacatctgcagcaaagtcaaggctgaggtg
cagaatctcggtggagagctcgttgtctctggggtggacagcgccatgtccctgatccag
gctgccaagaacttgatgaacgcggtagtgcagacggtgaaggcatcctatgtggcctcc
accaaataccagaagtctcagggtatggcttccctcaaccttccagctgtttcgtggaag
atgaaggcacctgagaaaaagcccttggtgaagagagagaaacaggatgagacacaaacc
aagattaaacgggcatctcagaagaagcatgtgaaccctgtgcaggccctcagcgagttc
aaagccatggacagcatctag

KEGG   Acinonyx jubatus (cheetah): 106978213
Entry
106978213         CDS       T04657                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha-2 isoform X1
  KO
K05691  catenin alpha
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04670  Leukocyte transendothelial migration
aju05100  Bacterial invasion of epithelial cells
aju05200  Pathways in cancer
aju05213  Endometrial cancer
aju05226  Gastric cancer
aju05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    106978213 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106978213 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    106978213 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106978213 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    106978213 (CTNNA2)
   05213 Endometrial cancer
    106978213 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106978213 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    106978213 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aju04812]
    106978213 (CTNNA2)
Cytoskeleton proteins [BR:aju04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     106978213 (CTNNA2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 106978213
NCBI-ProteinID: XP_026927896
UniProt: A0A6J2ADM1
LinkDB
Position
Unknown
AA seq 992 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLDKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGAPIGSGSSDSSMVYLQDSCIRLGEQRGSEEETGYHIFAAELDTIFLKMESVLDS
ATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREK
PEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 2979 nt   +upstreamnt  +downstreamnt
atgacttcggcaacttcaccgatcattttaaaatgggaccccaaaagtttggaaatccgg
acactaacagtggagaggcttttggagccacttgttacacaggtgaccacccttgtcaac
acaagcaacaaaggcccatctggtaaaaagaaagggaggtcaaagaaagcccacgtgctg
gctgcatctgtagagcaagccactcagaatttcctggataagggtgaacagatcgctaag
gagagtcaagatctcaaagaagaattggtcgctgctgtagaggacgtacgcaaacaaggt
gagacaatgcgcatcgcctcttcggagtttgctgatgacccgtgctcatcagtgaagcgt
ggcaccatggtgagggcggcgagggctttgctctcagctgtgacgcgcttactcatccta
gcggacatggcggatgtcatgagacttttatctcacctgaaaattgtggaagaggccttg
gaagctgtcaaaaatgctacaaatgaacaagaccttgcaaatcgctttaaagaatttggc
aaagaaatggtgaaactcaactatgtagcagcaagaagacaacaggagctgaaggaccct
cactgtcgggatgagatggcagccgcccgaggggctctaaagaagaatgccacaatgctg
tacacagcctcccaagcatttctccgccacccagatgttgctgccaccagagccaaccga
gattatgtgtttaaacaagtccaggaagccattgctggcatctccaatgctgctcaagct
acctcgcccaccgatgaagccaaaggccacacaggcatcggtgagctggctgcagctctg
aatgagtttgataataagataatcctggaccccatgacgttcagcgaggccaggttccgg
ccgtccctagaggagaggctggagagcatcatcagtggcgcggcgctcatggcagactcg
tcctgcacacgtgatgaccggcgcgagaggatcgtggccgagtgcaatgccgtccggcag
gcgctccaggacctgctcagcgagtacatgaacaacaccggaagaaaagaaaaaggagat
cctctaaacattgcaattgataagatgaccaagaaaacaagagacctaaggagacagctt
cggaaagcagtgatggatcacatatctgattctttcttggaaaccaatgtccctttgcta
gttctcattgaggctgcgaagagtgggaacgaaaaggaagtgaaggaatatgcccaagtt
ttccgtgagcatgccaacaagctggtggaggttgccaacttggcctgttccatttccaac
aatgaggaaggggtgaaattagtccggatggcagccacccagattgacagcctgtgtccc
caggtcatcaatgctgctctcacactggctgcccgaccacagagcaaagttgctcaggac
aacatggacgtcttcaaagaccagtgggagaagcaggtccgagtgttgacagaggccgtg
gatgacatcacctcagtggatgacttcctttctgtctcagagaatcacatcttggaggat
gtgaacaagtgtgtgatagccctccaagaaggggacgtggacactctggaccggactgca
ggggccattaggggccgggcagctcgagttatacacatcatcaatgctgagatggagaac
tatgaagctggtgtttatactgagaaggttctggaagctacaaaattgctctctgagaca
gtgatgccacgctttgctgagcaagtagaggttgccattgaagccctgagtgccaacgtc
cctcagccatttgaagagaatgagttcattgatgcctctcgcctggtatatgatggtgtt
cgagacatcaggaaggctgtgctgatgatcaggaccccagaagaactagaagatgattct
gactttgagcaggaggattatgatgtgcgcagccggacaagtgttcagactgaggatgac
cagctcattgcaggacagagtgcacgggccatcatggcacaactaccgcaggaggagaag
gcaaaaatagctgagcaggtggagatattccaccaagagaaaagcaagctggatgccgaa
gtggccaaatgggatgacagcggcaatgatataattgtgctggccaagcagatgtgtatg
atcatgatggaaatgacagacttcacaagaggcaaaggcccattgaaaaatacatctgat
gttattaatgctgccaagaaaattgccgaagcaggttctcgaatggacaagttagcccgc
gctgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaa
cgaattgctttgtattgccatcagcttaatatctgcagcaaggtgaaggcagaagttcag
aatctaggaggagagctcattgtgtcagggacaggagttcagagcactttcactaccttt
tatgaggtagattgtgatgtcatagatgggggcagggctagtcaactttctacccacctc
ccaacctgtgctgagggagctccgatcgggagtggaagcagtgattcctccatggtttat
ttacaggattcctgcatcaggctgggagagcaaaggggttctgaagaagagacaggctat
catatttttgctgcagaattagacaccatctttctgaaaatggaatctgtgctggacagt
gccacatcactcatccaggcagctaaaaacctgatgaatgctgttgtcctcacagtgaaa
gcatcctatgtggcctcaaccaaataccagaaggtctatgggacagcagctgtcaactca
ccggttgtgtcttggaagatgaaggctccagagaagaagccccttgtgaagagagaaaag
cctgaagaattccagacacgagttagacgaggttcccagaagaaacacatttcgcctgta
caggctttaagtgaattcaaagcaatggattcattctag

DBGET integrated database retrieval system