KEGG   Acinonyx jubatus (cheetah): 106967594Help
Entry
106967594         CDS       T04657                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aju00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106967594 (SETD1B)
Enzymes [BR:aju01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106967594 (SETD1B)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106967594 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     106967594 (SETD1B)
    COMPASS/SET1 complex (yeast)
     106967594 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 106967594
NCBI-ProteinID: XP_014919330
LinkDB All DBs
Position
Un
AA seq 1509 aa AA seqDB search
MKYTTTKPQKGGSFASAAREDRQRGLQMRPREFQCSPNSLPPRPCQIDEFYVGPVPPKQV
TFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVGFATVRGAKEAVSHLH
STSVMGXLDTKGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDG
SLSAGCGSGSSSVTPNSGGTPFSQDTAYSSSRLDTPNSYGQGTPLTPRLGTPFSQDSSYS
SRQPTPSYLFSQDPTVTFKARRHESKFTDAYNRRHEHHYVHNSCAVTAVAGAPAAFRGSV
DLPFGAVSSSGGSSGPPFTAQPQDSATFAHTPPPAQGGRPTFGWSPEPCDSPGTPTLESS
PAGLEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSSSSQLSPLAPFGT
NSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDDELDLGVGPRPPPEPGPPDPSGLLG
QTTEVALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPKPMVVTPGAAA
VAAPSVLPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQTQMLSRLMTGQ
GACPYPPFMAAAAAAGSAGVQXXXXXXAAAASAGLQFVNLPPYRGPFSLSNSGPGRGQPW
PPLPKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFD
EWWDKKERMAQASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLR
GAIRLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADTPCELAKRDP
KGVGVRRRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASDKEERESTE
EEEEGEEEEEEEEEEDEEEEEEEEEEGPRSQVSSSSTSSTSDKDDDAEDSDEQEESENED
EDIALSEASEKEEGDSDGEETVSIATSKVGAGSSSESSESSEFESSSESSSSSSEDEEEL
VAREEEEEEEEEEEQEEETAAAXXXXXXXXXXALEEDVATGAPVTESSVMEGEVDIEAED
GAPEERTSVLEEPPLPVCVEELAGCKEPSEEPCLKQEGARLLSPEPPAGETESRPPPSPE
VGSVPPPPPVEPTKLPFKELENQWPSEAIPPGPRGRDEVTEEFMDLAKVRGPWRRPPKKR
HEDLVASASPELSPPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYXLQQDNGMD
WLNDTLWVYHPSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTD
EPPTDTQGMSIPAQPHASTRAGSERRSXPRRXPCPPSDVLKFNQLKFRKKKLKFCKSHIH
DWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKC
GNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCG
SENCRGTLN
NT seq 4530 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaccaccacgaagccccagaaaggcggctccttcgcctcggccgcccgagag
gacaggcagagggggctgcaaatgcgtcctcgcgaatttcaatgttctccaaactccctt
ccccctcgtccctgccagatcgatgagttctacgtgggcccggtgcctccaaagcaggtg
acatttgccaagctgaatgataacatccgagaaaacttcctgagggacatgtgcaagaag
tatggggaggtggaggaggtggagattttgtacaaccctaagaccaagaagcacttgggc
attgccaaggtgggctttgccacggtcaggggagccaaagaggcggtttcgcacctgcac
agcacttcggtcatggganngctggacactaaaggggaaacccgcatgcggttctacgaa
ctgttggtcacgggccgatacacaccccagaccctcccagtgggtgagctggatgctgtc
tctccgatcgtgaatgagaccctgcagctgtcagatgctctgaagcgcctcaaggatggt
agtctgtctgcaggctgtggctccggctcctcctcggtcacccccaatagtggtgggaca
cccttctcgcaggacacggcgtactccagcagccgcctggacacccccaactcctacgga
cagggcacaccgctcacgccacgtctgggcacccccttctcgcaggactccagctactcc
agccgccagcccacaccctcctacctcttcagccaggaccccacggtgaccttcaaggcc
cggcgccacgaaagcaagttcacagatgcctacaaccgccgccacgagcatcattatgtc
cacaactcctgtgcggtcaccgcagtggccggggccccagctgccttcaggggctccgtg
gacctcccgtttggggcagtcagcagcagtgggggcagcagtggccctccattcactgcc
caaccacaggattcggccacgttcgcccacactccaccgcctgcccaaggtggccggccg
acctttggctggagccctgagccttgtgacagtccaggcacacctacgctggagtcctca
cctgcggggctggagaagccccacgacagcctggattcacgcatagagatgctgctgaag
gaacagcgcaccaagctgcccttccttcgagagcaggactcggatacggagctgcagatg
gagggcagccccatctcctcctcctcctcccagctctctccactggccccctttggcacc
aactcccagccaggctttcgaggccccacgccaccctcctcacgcccctccagcaccggc
ctggaggatatcagccccacgccgctacccgactcagacgaggatgatgagcttgacctg
ggcgtggggccccgcccccctccggagccaggccccccggacccttctggtcttctgggc
cagacaactgaggtagccttggacctggctggagacaggaccccaacctcagagaagatg
gatgagggccagcagtcctcgggcgaggacatggaaatctcggacgatgagatgccctca
gcccccatcaccagcgccgactgccccaaacccatggtggtgaccccaggggcggcagct
gtggcagccccctctgtgctgccacccccacccatcctaccaccgctgccgcccttccct
ccagggctgtttcccgtgatgcaggtggacatgagccacgtgctgggtggccagtggggt
ggcatgcccatgtccttccagatgcaaacgcagatgctgagccgtctgatgactggccag
ggcgcctgcccctacccgcccttcatggccgctgctgccgcggccggctccgccggggtg
cagnnnnnnnnnnnnnnnnctgccgcggccgcctcagccgggctgcagtttgtcaacctg
ccgccctaccggggcccgttctccctgagcaacagcggaccgggccgcgggcagccctgg
ccaccgctacccaagtttgacccatcagtgccgccaccaggctacgtgccacgccaggag
gacccacacaaggccactgtggatggcgtcctgctggtggtgctcaaagagctgaaggcc
atcatgaagcgtgacctgaaccgcaagatggtggaggtggtggctttccgcgccttcgac
gagtggtgggacaagaaggagcggatggcccaggcctctctgaccccagtgaagtcaggc
gagcacaaggacgaggacaggccaaagcccaaggaccgcatcgcctcgtgcctgctggag
tcgtggggcaagggcgagggcctgggctatgagggcctcggcctgggcatcgggctgcgc
ggggccatccgcctgccctccttcaaggtcaagaggaaggagccgccggacacagcctct
tctggtgaccagaagcgcctgcggccctcaacctctgtggacgaggaagatgaagagtca
gagcgagaacgggaccgggatatggcggacaccccttgtgagcttgccaagcgggacccc
aagggcgtgggcgtgcggcgccggccagcccggccgctggagctggacagtggcggggag
gaggatgagaaggagtcactgtcggtgtcctcatcatcatcggcgtcctcatcctcgggc
tcctccacgacctcaccctcatcctcggcctctgacaaggaggagcgggaaagcactgag
gaggaagaggagggggaggaggaggaggaggaggaggaggaggaggatgaagaggaggaa
gaggaggaggaggaggaaggccccaggagccaggtctcctcctcctcgacctcatccaca
tcagataaggatgatgacgctgaagacagtgatgagcaggaggagtctgagaatgaggac
gaggacatagccctgtcagaggcgagtgagaaggaagaaggggactcggacggagaggag
acggtgagcatcgccacgtccaaggtgggagctgggtcctccagcgagagttctgagtct
tctgagttcgaatcaagctccgagtcctcgtcgtcatcctcagaggatgaagaggagctg
gtggcaagggaggaggaggaggaagaggaggaggaggaggagcaggaggaggagaccgca
gcagcannnnnnnnnnnnnnnnnnnnnnnnnnnnaggccttggaggaggatgtggccacg
ggggcacctgtgacagagtcctcggtcatggaaggggaggtggacatcgaggctgaggac
ggagctcccgaggagcggacttccgtgctggaagagccccccttgcctgtgtgtgtcgaa
gagctggcaggctgcaaggagccctcggaggagccgtgcctgaagcaggaaggggccagg
ttgctgtctccagagccccctgctggagagacggagtcccggcccccgccttccccggaa
gtgggatcagtgccacctccaccccctgttgagcctaccaagctgccctttaaggagcta
gagaaccagtggccctccgaggccatccctccaggcccccgtgggcgcgatgaggtcacc
gaggagttcatggacctggccaaggttcgggggccctggcgccggccgcctaaaaaacgc
cacgaggacctggtggcctcagcctcgcccgagctctcaccaccgcagcccctcttccgg
ccccggtcggagtttgaggagatgaccatcctgtacgacatctggaacggtggcattgac
gaggaggacatccgcttcctgtgtgtcacttacnngctacagcaggacaatggcatggac
tggctcaacgacacactctgggtctaccatccctccaccagcctctcttcagctaagaaa
aagaaacgggacgatggcatccgtgagcacgtgacgggctgtgcccgcagcgagggtttc
tacaccatcgacaagaaggacaagctcagatacctcaacagcagccgcgccagcaccgat
gagcccccgacagacacccagggcatgagcatcccggcacagccacacgcctccactcgg
gccggctccgagcggcgttcttgaccacgccgcnccccctgccctcctagtgacgtgctc
aagttcaaccagctcaagttccggaagaagaagctcaaattctgcaagagccacattcac
gactggggcctgttcgccatggagcccatcgcggctgacgagatggtcattgagtacgtg
ggccagaacatccgccaggtgatcgcggacatgcgggaaaagcgttatgaggacgagggc
attggcagcagctacatgttccgggtggaccacgacaccatcatcgacgccaccaagtgc
ggcaacttcgcgcgcttcatcaaccacagctgcaaccccaactgctatgccaaggtgatc
acggtggagtcgcagaagaagatcgtcatctactcaaagcagcacatcaacgtcaatgag
gagatcacctacgactacaagttccccatcgaggacgtcaagatcccctgcctgtgcggc
tccgagaactgccgggggaccctcaactag

DBGET integrated database retrieval system