KEGG   Acinonyx jubatus (cheetah): 106967765
Entry
106967765         CDS       T04657                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju04010  MAPK signaling pathway
aju04012  ErbB signaling pathway
aju04014  Ras signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04915  Estrogen signaling pathway
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05211  Renal cell carcinoma
aju05212  Pancreatic cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05223  Non-small cell lung cancer
aju05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106967765 (TGFA)
   04012 ErbB signaling pathway
    106967765 (TGFA)
   04014 Ras signaling pathway
    106967765 (TGFA)
   04151 PI3K-Akt signaling pathway
    106967765 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    106967765 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106967765 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106967765 (TGFA)
   05212 Pancreatic cancer
    106967765 (TGFA)
   05225 Hepatocellular carcinoma
    106967765 (TGFA)
   05214 Glioma
    106967765 (TGFA)
   05211 Renal cell carcinoma
    106967765 (TGFA)
   05215 Prostate cancer
    106967765 (TGFA)
   05223 Non-small cell lung cancer
    106967765 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106967765 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 106967765
NCBI-ProteinID: XP_026928061
UniProt: A0A6J2AE23
LinkDB
Position
Unknown
AA seq 162 aa
MVPSAGQLALLALGLLLAVCQALENSTSALSADPPVAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIIACVL
IHCCQVRKHCEWCQALICRHEKPSALLKGRTACCHSETAYTT
NT seq 489 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccttgctcgcgctgggtcttctgttggctgtgtgc
caggccctggagaacagcacgtccgccctgagtgcagacccgcctgtggccgcagctgtg
gtgtcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgc
agatttttggtgcaggaagacaagccagcatgtgtctgccattctgggtatgttggtgca
cgctgtgagcatgccgacctcctggctgtggtggccgccagccagaagaagcaagccatc
accgccttggtggtggtctccatcgtggccctggctgtcctcatcatcgcatgtgtgctg
atacactgctgccaggtccggaaacactgtgagtggtgccaggccctcatctgccggcac
gagaagcccagtgccctgctgaagggaaggactgcttgctgccactcagagacagcttat
acaacttaa

DBGET integrated database retrieval system