KEGG   Acinonyx jubatus (cheetah): 106968224
Entry
106968224         CDS       T04657                                 

Definition
(RefSeq) uncharacterized protein LOC106968224
  KO
K17106  whey acidic protein
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:aju00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    106968224
SSDB
Other DBs
NCBI-GeneID: 106968224
NCBI-ProteinID: XP_026901845
UniProt: A0A6J1YBZ3
LinkDB
Position
Unknown
AA seq 335 aa
MSRAPLDGGGRQSTQASGSTGLSTGTQGSGPLGSGPFERLCWRGDRRRVESAGRAGAWRL
PWPLSTACVWPPPTWQCVLMGSTDTAPRKLCLGPAVKHVHPTQHPAGTPETTAVLMLGPP
KFPPGCQHRRHLPCTLTHLATSPGVRQTPSYQSGDPTNPKLPVPGGGPTNPKLPVLGVPR
TPSYQSWGPTNPTAPISCDNDPQDSEGTTLRITPCDKGHRPAKPNKGHTWKVGAEMQEPL
SPLGWGVPPPSMSTCHQPGSSLRFSQSCISRHFDEAVIDQLSPHVTTWLAPGHQPVLCHE
GPLPQSHRICLNSGVRKESLQTTHDTCISQETTRC
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtcccgggcacctctggacgggggcggcagacaaagcacacaggcctctgggagcacc
gggctgtccaccggcactcagggctctggccctctggggtctggcccctttgagaggctt
tgctggcgtggggacaggaggagagtggagtctgcagggagggctggggcttggaggttg
ccatggcctctctccacggcttgtgtgtggcccccacccacttggcagtgtgtgcttatg
gggagcacagacactgctcccaggaagctctgtttaggacctgcagtgaagcacgtgcac
cccacccaacacccagcgggcaccccagagaccactgcggttctgatgctaggccccccc
aagttcccaccaggctgccagcaccgcagacacctgccctgcaccctgactcacttagct
accagccctggggtccgacaaaccccaagctaccagtccggggatcccacaaaccccaag
ctaccagtcccaggggggggtcccacgaaccccaaactaccagtcctgggggtcccacga
accccaagctaccagtcttggggtcccacgaaccccacagctcccataagttgtgataat
gacccacaggactctgaaggcacaacacttcggatcacaccctgtgataaaggacacaga
ccagcaaagccaaataaaggccacacgtggaaggtgggagcagagatgcaggagcctttg
tccccactgggctggggcgtgccacctcccagcatgtccacatgtcaccaaccaggaagc
tccctgaggttttctcaaagctgcattagtaggcattttgatgaagctgttattgaccag
ctcagtccccacgtaaccacatggttggctccaggccaccagcctgtcctgtgccatgag
ggacccctaccccagagtcaccgcatctgtttaaactcaggcgtgagaaaggagtccttg
caaacaacacacgacacttgcatcagccaggaaaccacaaggtgttga

DBGET integrated database retrieval system