KEGG   Acinonyx jubatus (cheetah): 106968274
Entry
106968274         CDS       T04657                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X2
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju04012  ErbB signaling pathway
aju04062  Chemokine signaling pathway
aju04110  Cell cycle
aju04150  mTOR signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04310  Wnt signaling pathway
aju04340  Hedgehog signaling pathway
aju04360  Axon guidance
aju04390  Hippo signaling pathway
aju04510  Focal adhesion
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04657  IL-17 signaling pathway
aju04660  T cell receptor signaling pathway
aju04662  B cell receptor signaling pathway
aju04722  Neurotrophin signaling pathway
aju04728  Dopaminergic synapse
aju04910  Insulin signaling pathway
aju04916  Melanogenesis
aju04917  Prolactin signaling pathway
aju04919  Thyroid hormone signaling pathway
aju04931  Insulin resistance
aju04932  Non-alcoholic fatty liver disease
aju04934  Cushing syndrome
aju04935  Growth hormone synthesis, secretion and action
aju05010  Alzheimer disease
aju05020  Prion disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05135  Yersinia infection
aju05160  Hepatitis C
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05165  Human papillomavirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05215  Prostate cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106968274 (GSK3B)
   04310 Wnt signaling pathway
    106968274 (GSK3B)
   04340 Hedgehog signaling pathway
    106968274 (GSK3B)
   04390 Hippo signaling pathway
    106968274 (GSK3B)
   04151 PI3K-Akt signaling pathway
    106968274 (GSK3B)
   04150 mTOR signaling pathway
    106968274 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106968274 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106968274 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    106968274 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    106968274 (GSK3B)
   04657 IL-17 signaling pathway
    106968274 (GSK3B)
   04662 B cell receptor signaling pathway
    106968274 (GSK3B)
   04062 Chemokine signaling pathway
    106968274 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106968274 (GSK3B)
   04917 Prolactin signaling pathway
    106968274 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    106968274 (GSK3B)
   04919 Thyroid hormone signaling pathway
    106968274 (GSK3B)
   04916 Melanogenesis
    106968274 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    106968274 (GSK3B)
   04722 Neurotrophin signaling pathway
    106968274 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    106968274 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106968274 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106968274 (GSK3B)
   05225 Hepatocellular carcinoma
    106968274 (GSK3B)
   05226 Gastric cancer
    106968274 (GSK3B)
   05217 Basal cell carcinoma
    106968274 (GSK3B)
   05215 Prostate cancer
    106968274 (GSK3B)
   05213 Endometrial cancer
    106968274 (GSK3B)
   05224 Breast cancer
    106968274 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106968274 (GSK3B)
   05020 Prion disease
    106968274 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    106968274 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106968274 (GSK3B)
   04931 Insulin resistance
    106968274 (GSK3B)
   04934 Cushing syndrome
    106968274 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    106968274 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    106968274 (GSK3B)
   05162 Measles
    106968274 (GSK3B)
   05163 Human cytomegalovirus infection
    106968274 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106968274 (GSK3B)
   05165 Human papillomavirus infection
    106968274 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106968274 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106968274 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106968274 (GSK3B)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     106968274 (GSK3B)
Protein kinases [BR:aju01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   106968274 (GSK3B)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106968274 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 106968274
NCBI-ProteinID: XP_014920098
UniProt: A0A6I9ZEV6
LinkDB
Position
Unknown
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQTNSAASASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaagatggcagcaaggtaaccacagtg
gtggcaactcctgggcagggtcccgataggccacaagaagtcagctatacagacactaaa
gtgattggaaatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaagacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaagtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatatgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagacgta
tggtctgcaggttgtgtgttggctgagctgttgctaggacaaccaatatttccaggggac
agtggtgtggatcaattggtggaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattccctcaaattaaggcgcatcct
tggactaaggtcttccgaccccggactccaccggaggcaattgcactgtgtagccgtctg
ctggagtatacaccaactgcccgattgacaccactggaagcttgtgcacattcatttttt
gatgaactaagggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctagctaccattcttattcctcct
catgctcggattcaagcagctgcttcaacccctacaaatgccacagcagcctcagatgct
aatgctggagaccgtggacagaccaacagcgctgcttctgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system