KEGG   Acinonyx jubatus (cheetah): 106968455
Entry
106968455         CDS       T04657                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04071  Sphingolipid signaling pathway
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju04217  Necroptosis
aju04650  Natural killer cell mediated cytotoxicity
aju04932  Non-alcoholic fatty liver disease
aju05010  Alzheimer disease
aju05014  Amyotrophic lateral sclerosis
aju05022  Pathways of neurodegeneration - multiple diseases
aju05152  Tuberculosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    106968455 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106968455 (BID)
   04215 Apoptosis - multiple species
    106968455 (BID)
   04217 Necroptosis
    106968455 (BID)
   04115 p53 signaling pathway
    106968455 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    106968455 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106968455 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106968455 (BID)
   05014 Amyotrophic lateral sclerosis
    106968455 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    106968455 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106968455 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106968455 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106968455 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106968455 (BID)
   05161 Hepatitis B
    106968455 (BID)
   05160 Hepatitis C
    106968455 (BID)
   05164 Influenza A
    106968455 (BID)
   05162 Measles
    106968455 (BID)
   05168 Herpes simplex virus 1 infection
    106968455 (BID)
   05163 Human cytomegalovirus infection
    106968455 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106968455 (BID)
   05169 Epstein-Barr virus infection
    106968455 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106968455 (BID)
SSDB
Motif
Pfam: BID Bcl-2 CRM1_C DUF5631 DUF1002 bcl-2I13 TrbI_Ftype
Other DBs
NCBI-GeneID: 106968455
NCBI-ProteinID: XP_026929671
UniProt: A0A6J2AIP1
LinkDB
Position
Unknown
AA seq 196 aa
MDSQVSNGSSLQDERITNLLVFGFLQNCSNYNFHKELEVLGRELPVPPAYLQEDHDDGLQ
TDGNRCSRFLDSEETDSESQEEIIQDIARQLAQIGDRMDHSIHPRVVNNLAMQFMNVNLS
EEDRRKHLAAALEQVLQTYPKDMEREKTVLLLAMVLAKKVADHTPSLLRDVFRTTVNFIN
QNLLTYVRNLVRNEMD
NT seq 591 nt   +upstreamnt  +downstreamnt
atggattctcaggtcagcaatggttcaagcctccaggatgaacgcatcacaaacttgctg
gtgtttggcttcctccaaaactgctccaactataatttccataaagagttagaggtgttg
ggccgtgaactgcctgtgccaccagcttacctgcaggaggaccacgatgatgggctccag
acagatggcaaccggtgcagccgcttcttggatagcgaggagacagattctgagagtcaa
gaggaaatcatccaagatatcgccaggcagctcgcccaaatcggggataggatggatcac
agcatccacccaagagtggtgaataacctggcaatgcagtttatgaatgtgaacctgtca
gaagaagacagaaggaagcaccttgctgctgcactggagcaggtcctacagacttacccg
aaggacatggagagagagaagaccgtgctcttgttggccatggtattggccaaaaaggtg
gccgatcacacaccgtccttgctccgtgatgtctttcgcacaacagtgaactttattaac
cagaacctactcacatatgtgaggaacttagtcagaaatgagatggactga

DBGET integrated database retrieval system