KEGG   Acinonyx jubatus (cheetah): 106968508Help
Entry
106968508         CDS       T04657                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00052  Galactose metabolism
aju00500  Starch and sucrose metabolism
aju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106968508 (GANC)
   00500 Starch and sucrose metabolism
    106968508 (GANC)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106968508 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 106968508
NCBI-ProteinID: XP_014920374
LinkDB All DBs
Position
Unknown
AA seq 914 aa AA seqDB search
MEAAGKEEISVEDEAVDKNIFKDCSKIAFYRRQKQQLSTKSTYQALLDSATKGKDSTKFQ
ILNEATKVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVVTSKPRTVRLISSSGDAGS
LVLADGKGDLKCHITANPFKVDLVSEEEVVMSINSLGHLYFEHLQVPLKKRATKENKEDT
SVDTSQENQEDLGLWEEKFGKFVDVKVNGPASVGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKPGRTLGIFWLNASETLVEINTEPAV
KYTLTQMGPVAAKQKVRSRTDVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRNKKRKLVVISDPHIKIDPDYSVYAEAKEQGFFVRNHEGGDFEGVCWPGVSSYLD
FTNPKVREWYSSLFTFSAYQGSTDILYIWNDMNEPSVFRGPELTMQKNAIHHGNWEHREL
HNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSITGIPFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRQRYTLLPYWYFLFYRAHVAAEPVMRPLWIEFPKELNTFGVEDEYMLGSA
LLVHPVTEPKATTVSVFLPGSNEVWYDSKTGTYWEEACTVKIPVTLDSIPVFQRGGSIVP
IKTTIGKSTGYMTDSPYGLRVALSTKGSAVGELYLDDGHSFQYLHQKQFLHRKFSFFSGV
LTNSCADKRGHHPSKCVVERVFVLGLKKQPSSVTTHSSDGKEEPVVFTYCTTMSTLSLEK
LSLNIGVDWEVHIK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgctgggaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagactgcagcaagattgctttctacaggcgtcagaaacagcagctctccacaaag
tccacctatcaggcattactagactccgccacaaaaggcaaagacagcaccaagttccaa
atcctcaatgaagcaactaaggttcctcttctggctgaagtgtatggtatagagggaaat
attttcaggcttaaaatcaatgaagaaactcccctgaaacccaggtatgaagttcctgat
gttgtcacaagcaagccacgcaccgtaaggctgatttcatcctcaggggatgcaggtagt
ctggtattggctgatggaaaaggagatctgaagtgtcatatcacagcaaacccattcaag
gtagatttagtgtctgaagaagaggttgtgatgagcataaactccctgggccacttgtac
tttgagcacctgcaagttcctctcaagaaaagagctaccaaagaaaataaggaggacaca
tcagttgacacttctcaggaaaaccaagaggatctaggcttgtgggaggagaaattcgga
aaatttgtggatgtcaaagttaatggccctgcctccgttggtttggatttctccttgcac
ggatttgagcatctttacgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggtgatggcgatgcttaccgtctttataatctggatgtctatggatataaaatacatgac
aaaatgggcatttatggctcagtgccttatctcctggcccacaaaccaggcaggactcta
ggcattttttggctgaatgcctcagaaacgctagtggagatcaatacagagcctgcagta
aagtacacactgacccagatgggccccgttgcagctaaacaaaaggtcagatctcgaact
gatgtgcattggatgtcagagagtggaatcattgatgtttttctgctgacaggacctaca
ccttctgatgttttcaagcagtactcataccttacaggcacacaagccatgccccctctc
ttctctctggggtaccatcagtgccgctggaactatgaggatgagcaggatgtaaaagca
gtggatgcaggatttgatgagcatgacattccttatgatgtcatgtggctggacatagag
cataccgagggcaaaaggtacttcacctgggacaagaaaagattcccaaatcccaaaagg
atgcaagagctgctcagaaacaaaaaacgtaagcttgtggtcatcagtgacccccacatc
aagattgatcctgactactcagtgtatgctgaggccaaagaacagggcttctttgtgagg
aatcacgaaggaggagactttgaaggggtatgctggcctggtgtctcctcttacctggat
ttcaccaatcccaaggtcagagagtggtattcaagtcttttcactttctctgcctatcag
ggatctactgacatcctctacatatggaacgacatgaatgagccctctgtctttagagga
ccagagctaaccatgcagaagaatgccattcatcatggcaattgggagcacagggaactt
cacaacatctatggtttttatcagcaaatggctactgcagaaggactgatacagcgatct
aaaggaaaggagagaccctttgttcttacacgttctttctttgccggatcacaaaagtat
ggtgctgtgtggacaggcgacaacacggcagaatggagctacctgaaaatttctatccct
atgttactcaccctcagcattactgggatccctttttgtggagctgacgtaggtggcttc
attgggaatccagaagcagagctgctagtgcgttggtaccaggccggagcctaccagccc
ttcttccggggccacgctaccatgaacaccaagcggcgggagccatggctctttggggag
gaacacacccggctcatccgagaagccatcagacagcgctacaccctcctgccctattgg
tattttctgttctaccgggcacacgtggctgccgaacccgtcatgaggcctctatggata
gagttcccaaaggaattaaacacttttggtgtggaagatgaatacatgctaggaagtgct
ttattggttcatccagtcacagaaccaaaagccaccacagtcagtgtgtttctgccagga
tcaaatgaggtctggtatgactctaaaacgggtacttattgggaagaagcatgtactgtg
aagatcccagtaactttggactctataccagtgtttcaacgaggtggaagtatagtgccc
ataaagacaactataggaaaatccacaggctacatgactgattccccatatggactccgg
gtggctctcagcactaagggttctgccgtgggtgaactctatctcgacgatggccattca
ttccagtacctccaccagaagcaattcttgcataggaagttttcattcttttcaggtgtt
ttgaccaacagttgtgctgacaaaagaggtcatcatcccagcaagtgtgtggtggagcgg
gtcttcgtccttggcctcaagaagcagccatcttctgtgaccacccattcatctgacggt
aaagaagagcctgtggtttttacatattgtaccacaatgtccaccctgagcctggagaag
ctgtcactgaacatcggcgttgactgggaggtccacatcaaataa

DBGET integrated database retrieval system