KEGG   Acinonyx jubatus (cheetah): 106969353Help
Entry
106969353         CDS       T04657                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju05034  Alcoholism
aju05165  Human papillomavirus infection
aju05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    106969353 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    106969353 (HDAC7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    106969353 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106969353 (HDAC7)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106969353 (HDAC7)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106969353 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 106969353
NCBI-ProteinID: XP_014921348
LinkDB All DBs
Position
Un
AA seq 922 aa AA seqDB search
MILPCVNRAVRSCTLCMQGCVRSDGTQVSPGAHCPSPPGTGRLRPPARAPGAVASSVVKQ
KLAEVILKKQQAALERTVHPNSPSIPYRTLEPLETEGAARSMLSSFLPPVPSLPSDPPEH
FPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPAS
GCSSPNDSEQGPNPVLGSEALLGQRLRLQETSXPFALPTVSLLPAITLGLPAPARADADR
RTHPTLGPRGPVLGSPHAPLFLPHSLESESGGPLSSRLQPILLLDPSVSHAPLLTVPGLG
PLPFHFAXXXXXXXXXSGLHRPLSRTRSEPLPPSATAPPPLGPLQPRLDRLKPHVQLIKA
SPAKGEKPRLRQIPSAEDLETDGGGVGPLGDDGLEHRESSHGQHEARGPIPLQQHQQVFL
WEQQRLAGRLPRGGTGDSVLLSLAQGSHRPLSRAQSSPAAPASLPTPEPASQARVLPSSE
TSARTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRSQCECLRGR
KASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWN
ELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACR
QLQQQGKAGKILIMDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAG
SGEGFNVNVAWAGGLDPPMGDPEYLAAFRMVVMPIAREFSPDLVLVSAGFDAAEGHPAPL
GGYHVSAQCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDPLSEE
GWKQKPNLNAIRSLEAVIQVHSKYWGCMQRLASCPDSWVPRVPGADTEEVEAVTALASLS
VGILAEERPSQQLVEEEEPMNL
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgattctgccctgtgtaaacagggctgtgcgctcgtgtaccctgtgtatgcaaggctgc
gtgcgctcagatgggacccaggtgagcccgggtgcccactgccccagtccccctggcaca
ggccgcctcaggcccccagcgagggcccctggtgccgtagctagcagtgtggtcaagcag
aagctggcagaggtgattctaaagaagcagcaggcagccctagagagaacagtccatccc
aatagccccagcattccctacagaactctcgagcccttggagacggaaggagctgctcgc
tctatgcttagcagctttctgcctcctgttcccagcctgcccagtgaccccccagaacac
ttccctctccgaaagacagtctctgagcccaacctgaagctgcgctacaagcccaagaag
tccctggagaggaggaagaatccactgctcagaaaggagagcgccccgcctagtctccgg
cggcggcctgcagagaccctcggtgactcctcccccagtagcagcagcacaccagcatca
gggtgcagctcccccaatgacagcgagcaaggccccaaccccgtcctgggctcggaggcg
ctcttgggccagcggctgcggctgcaggagacctctnccccgttcgccttgccgacagtg
tccttgctgcccgcaatcacgctggggctccccgcccctgccagggctgatgctgaccgc
aggacccatccgacactgggccctcgggggccggtcctggggagcccccatgctcccctc
ttcctgccccacagcctggagtctgagtctgggggccccttgtcctctcgactacagccc
attctcctcctcgatccctcagtctctcacgcgcccctgctgactgtgcccgggcttggg
cccctgcccttccactttgcccnnnnnnnnnnnnnnnnnnnnnnnnngtcaggcctccac
cggccactaagccggacccgctcagagcccctgcccccaagcgccaccgcccccccaccg
ctgggccccctgcagccccgcctggaccggctcaaacctcacgtccagctgatcaaggcc
agcccagccaagggtgagaagccccgactgcggcagatcccctcagctgaggacctggag
acagatggtgggggagtggggccgctgggggatgacggcctggagcacagggagtcaagc
catgggcagcacgaagccagaggccctattcctctccagcagcaccagcaggtgttcctc
tgggagcagcagcgactggctgggcggctcccacggggaggaactggggactctgtgctg
ctttccctggcccagggcagtcaccggcccctgtccagggctcagtcatccccagctgcg
cctgcctcactgccaaccccagagcctgccagccaggcccgtgtcctgcccagctcagag
acctctgccaggaccctgccgttcaccacagggctggtgtatgactcggtgatgctgaaa
caccagtgctcctgcggggacaacagcaggcacccggagcacgcgggccgtatccagagc
atctggtcccggctgcaggagcgggggctccggagccagtgtgagtgtctccggggccgg
aaggcctccctggaggagctgcagtcagtgcactccgagcggcacgtgctcctctatggc
accaacccgctcagccgcctcaaactggacaacgggaagctggcagggctcctggcacag
cggatgtttgtgatgctgccctgtggtggggtaggggtggataccgataccatctggaat
gagctgcattcttccaatgcggcccgctgggcagccggcagtgtcactgaccttgccttc
aaagtcgcttcccgtgagctaaagaatggttttgctgtggttcggcccccaggacaccat
gcggaccattccacagccatgggcttctgcttcttcaactccgtggccattgcctgccgg
cagcttcaacaacagggcaaggccggcaagatcctcatcatggactgggatgttcaccat
ggcaatggcacccagcaaaccttctaccaggaccccagtgtgctctacatctccctgcat
cgccatgatgatggcaacttcttccccggcagtggggccgtggatgaggtgggagctggc
agcggtgagggcttcaatgtcaacgtggcctgggcaggaggtctagacccccctatgggg
gatcctgagtacctggctgccttcaggatggttgtgatgcccattgcccgagagttctct
ccggacctggttctggtgtcagctgggtttgatgctgccgagggtcacccagccccgctg
ggtggctaccatgtttccgctcaatgttttgggtacatgacccagcagctgatgagcttg
gcgggaggtgcagtggtgctggccttggaaggtggccatgacctcacagccatctgtgac
gcttctgaggcctgtgtggctgctcttctgggaaacaaggtggatcctctctcagaagaa
ggctggaagcagaaacccaacctcaacgccatccgctctttggaagccgtgatccaggtg
cacagtaaatactggggctgcatgcagcgcctggcctcctgtccagactcctgggtgccc
agggtgccaggggccgacacagaagaagtggaggcagtgaccgcactggcatccctctcc
gtgggcatcctggctgaagagcggccctcacaacagctggtggaggaggaagaacctatg
aatctctaa

DBGET integrated database retrieval system