KEGG   Acinonyx jubatus (cheetah): 106969949
Entry
106969949         CDS       T04657                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04110  Cell cycle
aju04115  p53 signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04218  Cellular senescence
aju04934  Cushing syndrome
aju05160  Hepatitis C
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05165  Human papillomavirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05206  MicroRNAs in cancer
aju05212  Pancreatic cancer
aju05214  Glioma
aju05218  Melanoma
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    106969949 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106969949 (CDK6)
   04115 p53 signaling pathway
    106969949 (CDK6)
   04218 Cellular senescence
    106969949 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106969949 (CDK6)
   05206 MicroRNAs in cancer
    106969949 (CDK6)
   05203 Viral carcinogenesis
    106969949 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    106969949 (CDK6)
   05225 Hepatocellular carcinoma
    106969949 (CDK6)
   05214 Glioma
    106969949 (CDK6)
   05220 Chronic myeloid leukemia
    106969949 (CDK6)
   05218 Melanoma
    106969949 (CDK6)
   05224 Breast cancer
    106969949 (CDK6)
   05222 Small cell lung cancer
    106969949 (CDK6)
   05223 Non-small cell lung cancer
    106969949 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106969949 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    106969949 (CDK6)
   05164 Influenza A
    106969949 (CDK6)
   05162 Measles
    106969949 (CDK6)
   05163 Human cytomegalovirus infection
    106969949 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106969949 (CDK6)
   05169 Epstein-Barr virus infection
    106969949 (CDK6)
   05165 Human papillomavirus infection
    106969949 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106969949 (CDK6)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106969949 (CDK6)
Protein kinases [BR:aju01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106969949 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 106969949
NCBI-ProteinID: XP_026927685
UniProt: A0A6J2AGZ7
LinkDB
Position
Unknown
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSPQPIEKFVTDIDEQGKDLLLKCLTFNPAKRISAYSALSHPYF
HDLERCKENLDSRLPPNQNSSEMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgcgcggaccagcagtacgagtgcgtggcggagatcggg
gagggcgcctatggaaaggtgttcaaggcccgggacctgaagaacggaggccggttcgtg
gcgctgaagcgcgtgcgggtgcagacaggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtatgcacagtgtcacgaacagacagagaaaccaaactaacattagtgtttgaacat
gttgatcaagacctgaccacttatttggataaagtcccggagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattctcaccga
gtagtgcatcgtgatctaaaaccgcagaacattctggtgaccagcagcggacaaataaaa
ctggctgactttggccttgcccgcatctacagttttcagatggctctcacctcagtggtc
gtcacgctgtggtacagagctccagaagtcttgcttcagtccagctacgccacccccgtg
gacctctggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagacgttgatcaacttggaaaaatcttggatgtaattggactcccaggagaa
gaagactggcccagagatgtcgcccttcccagacaggcttttcactcaaaatctcctcaa
ccaattgagaagttcgtaacagatattgatgaacaaggcaaagacctactcctgaagtgc
ctaacctttaatccggccaaaagaatatctgcctacagtgccctgtctcacccctacttc
catgatctggagaggtgcaaggagaatctggattcccgtctgcctcccaaccagaacagc
tcagagatgaatacagcctga

KEGG   Acinonyx jubatus (cheetah): 106975871
Entry
106975871         CDS       T04657                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4 isoform X1
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01522  Endocrine resistance
aju04110  Cell cycle
aju04115  p53 signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04218  Cellular senescence
aju04530  Tight junction
aju04660  T cell receptor signaling pathway
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju04934  Cushing syndrome
aju05160  Hepatitis C
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05212  Pancreatic cancer
aju05214  Glioma
aju05218  Melanoma
aju05219  Bladder cancer
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    106975871 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106975871 (CDK4)
   04115 p53 signaling pathway
    106975871 (CDK4)
   04218 Cellular senescence
    106975871 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106975871 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    106975871 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106975871 (CDK4)
   05203 Viral carcinogenesis
    106975871 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    106975871 (CDK4)
   05225 Hepatocellular carcinoma
    106975871 (CDK4)
   05214 Glioma
    106975871 (CDK4)
   05220 Chronic myeloid leukemia
    106975871 (CDK4)
   05218 Melanoma
    106975871 (CDK4)
   05219 Bladder cancer
    106975871 (CDK4)
   05224 Breast cancer
    106975871 (CDK4)
   05222 Small cell lung cancer
    106975871 (CDK4)
   05223 Non-small cell lung cancer
    106975871 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106975871 (CDK4)
   04934 Cushing syndrome
    106975871 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106975871 (CDK4)
   05160 Hepatitis C
    106975871 (CDK4)
   05164 Influenza A
    106975871 (CDK4)
   05162 Measles
    106975871 (CDK4)
   05163 Human cytomegalovirus infection
    106975871 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106975871 (CDK4)
   05169 Epstein-Barr virus infection
    106975871 (CDK4)
   05165 Human papillomavirus infection
    106975871 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    106975871 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106975871 (CDK4)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106975871 (CDK4)
Protein kinases [BR:aju01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106975871 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 106975871
NCBI-ProteinID: XP_014928729
UniProt: A0A6I9ZQG2
LinkDB
Position
Unknown
AA seq 307 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGASGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVSRKVV
TLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPED
DWPRDVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLQ
KAEGNPE
NT seq 924 nt   +upstreamnt  +downstreamnt
atggctactcctcgatatgagccagtggccgagattggtgttggtgcttatggaaccgtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtccct
aacggaggaggtgctagcgggggccttcccatcagcacagttcgtgaggtggccttactg
aggcggctggaggcttttgaacatcccaatgttgtccggctgatggatgtctgtgccact
gcccgaactgaccgagagaccaaagtgaccctggtgtttgagcatgtggaccaagaccta
aggacatatctggacaaggcacccccaccaggcttgccagtggagactatcaaggatctg
atgcgccagtttctaagaggcctagatttcctccatgccaactgcattgttcatcgagat
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctatcagatggcacttacacctgtggtcagtagaaaggttgtt
acactctggtaccgtgctccggaagttcttctgcagtctacgtacgcaacacctgtggac
atgtggagcgttggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtgga
aactctgaagctgaccagttaggcaaaatctttgacctgatcgggctgcccccagaggat
gactggccccgagatgtgtctctgccccgaggagccttttcccccagaggaccccgtcca
gtgcagtcagtggtacctgagttggaggagtctggagcacagctgctgctggagatgctg
acttttaacccacacaagcgaatctctgccttccgagccctgcagcactcttatctacaa
aaggcagaaggtaacccagagtga

DBGET integrated database retrieval system