KEGG   Acinonyx jubatus (cheetah): 106970401Help
Entry
106970401         CDS       T04657                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00052  Galactose metabolism
aju00500  Starch and sucrose metabolism
aju01100  Metabolic pathways
aju04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106970401 (MGAM2)
   00500 Starch and sucrose metabolism
    106970401 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    106970401 (MGAM2)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     106970401 (MGAM2)
    3.2.1.20  alpha-glucosidase
     106970401 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 106970401
NCBI-ProteinID: XP_026931441
LinkDB All DBs
Position
Unknown
AA seq 2377 aa AA seqDB search
MARNLSVLEVLLIIFFLTILALDIFLMLLVLGNPSGRSFVPECPDIPESERIDCVPGHVV
TENVCRWVYKCCWKPVTHTGAPRCFFPRNWGYKVGKRQNDTTGFTAKLKRLPTPSLFGYD
VPDVLFAADYQTSNRFHFKITDMDSKRYEVTLENIDLLDRTPKTSNLNYHVEVINEPFSF
KIIRTSNKRILLDTSIGPLQFAHQYLQLSFRLPSTSVYGLGEHVHQQYLHNLTWKTWPIF
TRDATPTKGMINLYGAHTFFLCLEDTSGSSFGVFLLNSNAMEVILQPAPAITYRTIGGIL
DFYVFLGNTPEQVVQEYLELIGRPFLPPYWSLGFQLSRRNYGGINGLRKVVDRNRGAGIP
YDVQYSDIDYMEGGKDFTIDKEAFPRLEDFAKDLHGQGMKYVIIMHPGILNKSNYHPYET
GSKKRVWIWQDNEFAIGQGYPGLTVFPDFSNPVCIEWWREQISEFHKTLEFDGVWIEMDE
VSSFHHGSNGGCESNHLNVPPFTPRVLDGFLSARTLCMDAEFHQGLHYDVHSLYGYSMAK
ATHFAMEGIPLNKSSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIP
MVGANICGYTKNVTEELCRRWMQLGAFYPLSRNHNGPEFVDQDPVAFGSHSLLVNSSKHY
LNIRYALLPYLYTLFYRAHTRGDTVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVLYE
GVDQVKAYIPDAMWYDYETGVAIQWRKQLVEMQLPPDRIGLHLRGGFIFPTQQPNTTTEA
SRKNPLGLIVALDYKREAKGELYWDNGEFKDEKYILYDFSVASNHLQAKVINNNYTDPNN
LTFTDIIILGMDKQPMNFTVSLKNSYRSILNVTYNVSSKVVKITDLKGLVLGQEFSIKWE
LPVSDLEKFNCYPDEPPLTLEHCRKRGCLWEDTTVPGVPTCYYDTIPNYAASNIQYLPTG
ITTDLTHLMTPESTRAATAAGSLSAMISFLRLSVIYHTENMLQFKIFDATNKRYEVPVPL
NTPRSPVGSPENRLYDVRIQNNPFGIQIRRKSSNTVIWDSQLPGFTFNDTFLSISTRLPS
QYLYGFGETEHTAFRRNMSWNMWGMFARDEPPAYKKNSYGVHPYYMALEQDGSAHGVLLL
NSNAMDVSFQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGRPAMTPYWALGFQL
SRYGYKNDKEISQLYEAMMAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLGLLIDQMKKN
GMRFVLILDPAISGNETHYPTFKRGQENNVFIKWPDNNEIVWGKVWPDLPNVNVDATLDH
ETQVKLYRAYVAFPDFLRDSTAAWWKKEIQELYVNPQEPKKSLKFDGLWIDMNEPSNFVD
GSVRGCSDKSLNKPPYMPHLESRDMGLSSKTLCMESQQILPDGSRVRHYDVHSLYGWAQT
RPTYEAVQAVTGQRGVVITRSTFPSSGRWGGHWLGDNTAAWDQLRKSIIGMMEFSLFGIS
YTGADICGFFGNAEYEMCLRWMQLGAFYPFSRNHNTIGTRRQDPVAWNSTFEMYSRKVLQ
TRYALLPYLYTLMHKAHVEGSTVVRPLLHEFTNDRVTWDIDRQFMLGPAILISPVLESNT
FEIQAYFPRARWYDYSTESGNASTGYWKTLEAPLDHINLHIRGGYILPWQEPAMNTQASR
QKFMGLIVALDDNGKAEGQIFWDDGQSIDTYENGNYFLANFIAAQNILQIQTMHNKYLSD
SNPLKVGYIKIWGVNSTYVTQVTFTYDNKQFMEKNFKSDPYNQILTIQLTDKIINLEKLT
EVTWIYGGPIISTTPMTSTFPTESLHPSTVTTKATTFETVITSSASTTTTLPITTTPFPT
STMEDTTNTTITNSTIPSSTSTPTASTSTLPITTTPFSTSTIEMTTSTTSSDPTTPSSTS
TSAASLSTLPITTTPFPTSTIEVTTSTAGPDTPTPATTSATTSTISNTTLPITTTPFPTS
ASEATTSTSGPDTTTPIPSSTSIPTANTSTLPVTTTPFPTSTIELTTSTIIPNTTTPSPT
STTASTSTLPVTATPFPTSTTEVTTSTTHPDTTTPSPTTTANATTTLPIATALFPTSTIE
VTTSTTIPDATIPSATSTTANTSSIHPITTTPFPTNTTDASTNTSVLITATLSPISTDTT
TINNSVLITPTASPMNAGANTTNNSFPITTPFSVSTYDANTAIAMVTTSFTSTDVAHAGN
HTPITSSPSLMISGGNSTSITIPTTSTPSSTDIYSPSTSVIANTTTNTVNGTGHAVNITD
ADNSNSVPYNTTHVSIPNATMASDTLMTVLLDTAAHNQVTANSAVSYLPIVATNATTDST
NITIYALNTTILDRTTMDASTPVSTYIANTVNATLVP
NT seq 7134 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaatctgagtgtgttggaagtccttctgatcatcttcttcctaactatactc
gccttagatatcttcttgatgcttttggtgttgggaaatccttcaggtcgttcatttgtt
ccagagtgcccagatatccccgaatcagagaggatagactgtgttcctgggcatgtggtg
acagagaatgtctgcagatgggtatataaatgctgctggaagcctgtgacacatacaggt
gccccgaggtgcttcttccctaggaactggggctataaagttggcaagagacagaatgac
acaacagggtttaccgccaagttgaaaaggctacctaccccatctctgtttggatatgac
gtccctgacgtcctcttcgcggctgactatcagacatccaatcgttttcattttaagatc
actgatatggatagcaaacgctatgaagtcacccttgaaaatattgacttgcttgatagg
actcctaagacctctaatttgaactatcacgtagaggtcattaatgagcccttcagcttc
aagatcatacggaccagcaacaaaagaatcttgttggacacgagcatcgggcccctgcag
tttgcccatcagtacctgcagctgtctttccgactgcccagcacctccgtgtatgggctg
ggagaacacgtgcatcagcagtacctccacaacctgacctggaagacctggcccatcttc
actcgggatgccacccccaccaagggcatgattaatctgtatggagctcatacattcttc
ctgtgcctcgaagacaccagcggctcctcttttggggtttttctgttgaacagtaatgcc
atggaggtcatccttcagcctgctcctgcaatcacttaccgcacgattgggggcatcctt
gacttttatgtattcctgggaaatactccagaacaagtggttcaggaatatctggagctc
attggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgcaggaac
tatggcggaatcaatggattgaggaaggttgtggaccgaaatcgtggagctgggatccca
tatgatgtccagtactctgacatagactacatggaagggggaaaggatttcacgattgat
aaagaggctttccctcgtcttgaagattttgccaaagacttgcatggccaaggaatgaaa
tatgtgatcattatgcatcctggaatattaaataaatctaactaccatccctatgagact
ggaagtaagaagagagtatggatctggcaggacaatgaatttgccattggacagggatat
cccggattgacggtctttcctgattttagcaatccagtttgtattgagtggtggagagag
cagatcagtgaatttcataaaactctcgagtttgatggagtgtggattgaaatggatgaa
gtatccagctttcaccacgggtccaatggtgggtgtgagtcaaaccacttgaacgttcct
cctttcactcccagagttctggacggcttcctttctgcaagaaccctctgcatggatgca
gaatttcatcagggccttcactatgatgtccacagcttgtatggctactccatggcaaaa
gctacacactttgccatggagggtatccccttgaacaaaagtagcttcatcttatcccgt
tctacttttgctgggtctggcaagtttgctgctcattggttgggagacaatgcagccaca
tgggatgatctccggtggtccatccctagtatccttgagttcaacctatttggtatcccc
atggtaggtgccaacatctgtggttatacaaaaaatgtcacagaggagctctgcagaagg
tggatgcagcttggagccttttatccactatcaaggaatcataatgggcctgagtttgtg
gatcaggatcctgttgcctttggcagccactctctgctggtgaattcctccaaacattat
ctgaacatccgctacgctctactcccctatctctacacccttttctaccgagctcacacc
cggggagacaccgtggcaaggccccttgtccatgagttctaccaggacccagctacatgg
gaggtgcacgagcagttcttatgggggcctggacttctcatcacacctgttttatatgag
ggtgtggaccaagtgaaggcatacataccggatgccatgtggtacgactatgagacagga
gtagctatccagtggaggaaacaactggtagagatgcagctaccacccgataggattgga
cttcacctccgtgggggcttcatatttcccacccagcagcccaacacaaccacagaggcc
agtcggaagaatcccctgggactcattgttgccttggactataagagagaagcaaaggga
gagctgtactgggataatggtgaattcaaagatgaaaagtatattctgtatgatttttct
gtcgcctctaaccatctacaggcaaaggttataaataataactatacggaccccaacaac
ctcacgtttacagatatcataatcttgggaatggacaagcaacctatgaatttcactgtt
tcattgaagaattcttacaggtccattttaaatgttacctacaatgtttcatcaaaggtg
gtgaagattactgatctcaagggactggtacttggacaagaattctccattaaatgggaa
cttccagtcagtgacctggagaaattcaactgctaccctgatgagccccccctcactctg
gagcattgcaggaagcggggctgcctctgggaggacacaactgttcctggtgtgcctacc
tgttactatgacaccatccctaattatgctgccagtaacattcagtacctgcccacgggc
atcaccacagacctcacccacctgatgacccctgaatcaactcgagcagccactgctgct
ggttctctttctgcaatgatcagcttcctccgcctgagtgtcatctaccacacagaaaac
atgctgcagttcaagatctttgatgccactaacaaaaggtacgaggtcccagtgcctctg
aacacgcctcgctctcctgttggctcccctgaaaaccgtctgtatgatgtcaggattcag
aacaatccttttgggatccagattcgacgaaaaagctccaacactgtgatttgggactct
cagctccccggctttactttcaacgacacgttcctctccatttcgactcgcctcccctct
cagtacctctacggctttggggagactgagcacacagctttcaggagaaatatgagctgg
aacatgtggggaatgttcgctcgtgatgagccacccgcgtacaagaagaattcctatggc
gtccacccctactacatggcactggagcaggatggcagtgcccatggggtgctcctgcta
aacagcaacgccatggatgtatcattccagcccactcctgccctgacataccgcaccaca
ggagggattttggacttttatatggttttggggccaacccccgagcttgtaactcaacag
tacactgagttgattggtcggccagcaatgactccatactgggccttgggattccagcta
agtcgctatggatacaagaatgataaggagatctcccaattgtatgaggcaatgatggcg
gcccagattccctatgatgtccagcatgtagacatcgattacatggaccggaagctggac
ttcactctcagccccagcttccaaaacctcggtctcttgattgaccaaatgaagaaaaat
ggcatgagattcgtcctcattctggacccagccatttctggcaacgagacccattatccc
acattcaagagagggcaggaaaacaacgtattcatcaaatggcctgataacaatgaaatc
gtctggggaaaggtttggccagatttgcccaatgtgaatgtggatgccacccttgaccat
gaaactcaggttaagctgtacagagcctacgttgcttttcctgacttcttacgtgatagc
acagctgcatggtggaagaaggaaatacaggagctctatgtgaaccctcaagagccaaag
aagagcttgaagtttgatggattgtggattgacatgaatgagccatcaaactttgtggat
ggatctgtcaggggctgcagcgataaaagtcttaacaagccaccctatatgccacatttg
gagtccagggacatgggccttagcagcaagaccctgtgcatggagagtcagcagatcctg
ccagacggctcacgggtgcgacactatgacgtgcacagcctgtacggatgggcccagacc
agacccacctacgaagccgtgcaggcggtgacaggacagcgaggggtcgtcatcacccgc
tccacgttcccttcttctggccgctggggaggtcactggctgggagacaacacggccgcg
tgggaccagctgaggaagtctatcattggcatgatggagttcagtctctttggaatatct
tatacaggagcagatatttgtgggttctttggaaatgccgaatatgagatgtgtcttcgc
tggatgcagctgggggccttttacccattttccagaaaccacaacaccatcgggacaagg
agacaagatcctgtggcctggaattcaacttttgagatgtactcaagaaaagtccttcag
accagatacgccctgctgccttacctctacactttgatgcataaagctcatgttgagggc
agcactgtcgtccgaccccttctccatgagtttacaaatgacagagtgacatgggatata
gaccgtcagtttatgttgggtcctgctatcttaatcagccccgtgctggaaagtaacact
tttgagatccaagcctattttcccagagcccgttggtacgactacagcacggaatctggc
aatgcgtcaacaggttactggaaaaccctggaggctccccttgaccacatcaaccttcat
atcagaggaggctacatcctgccctggcaagagcctgcaatgaacactcaggccagtcga
caaaaatttatgggattgattgttgctttggatgacaatgggaaagctgaaggtcagata
ttctgggacgatggacaaagcattgatacctatgaaaatggaaactatttcttggcaaac
tttatagcagctcagaacatattgcaaatccaaaccatgcacaataagtatttgagtgac
tcaaatccactgaaagttggatatattaaaatctggggggtaaactctacttatgtgaca
caagtcacttttacttatgacaacaagcaattcatggagaagaatttcaagagtgaccct
tacaatcagatactaacaattcaattgactgacaagattatcaacctggaaaaactaact
gaggttacctggatatacggtggccctataatttccactacacctatgacaagtaccttc
ccgacagagtctctacatccttctacagttacgactaaggctaccacttttgaaactgtt
atcactagttctgcgagtactactacgactcttcctatcacaaccactcctttcccaaca
agtactatggaagatacaacaaatactactattactaatagcactataccatcctctaca
agtacccctactgctagcactagtactcttcctatcacaaccactcctttctcaacaagt
actattgaaatgacaactagtactaccagttctgatcccactacaccatcctctacaagt
acctctgctgctagtcttagtactctgccgatcacaaccactcctttcccaacaagtact
attgaagtgacaacaagtactgctggtcctgatacccctacacctgccactacaagtgct
actactagtactatttctaatactacgcttcctattacaaccactcctttcccaacaagt
gctagtgaagctacaactagtacttctggacctgataccactacacctataccatcctct
acaagtattcctactgctaacactagtactcttcctgtcacaaccactccattcccaaca
agtactattgaacttacaactagtactattattcctaataccactacaccgtcccctaca
agtaccactgctagcactagtactcttcctgtcacagccactcctttcccaacaagtact
actgaagttaccactagtactacccatcctgataccactacaccttcccctacaactacg
gctaatgctactactactcttcccattgcaacagctcttttccctacaagtactattgaa
gttacaactagtactactattcctgatgccactataccatctgctaccagtactactgct
aatactagtagtattcatcctatcacaaccacccccttcccaacaaatactactgatgct
agcaccaatactagtgttcttattaccgctactctttccccaataagtaccgataccact
accattaataatagtgttttaattacacccactgcttctcctatgaatgcgggtgctaat
actactaacaacagttttcctattacgactcctttttctgtaagtacttatgatgcaaac
actgctattgctatggtaacgacttcttttacaagtactgatgttgctcatgctggcaac
cacactcctattaccagttctccttcccttatgatatccggtgggaatagcactagcatt
actattcctacaacgtctactccttcttctacagatatttattctcctagcactagtgta
atagctaataccaccaccaacactgtaaacggtacagggcatgcagtaaatattactgat
gcagataactctaacagtgttccatataacactacccatgtttctattccaaatgctaca
atggcctcagacacattaatgactgttcttctagatacagcagctcacaatcaggtaaca
gccaactctgcagttagttatttacctattgttgcaactaatgctaccacagatagtaca
aatattaccatatatgctttaaacactaccattcttgatagaacaacaatggatgcttct
actcctgtatctacctacattgcaaacaccgtaaatgctactctagttccatga

DBGET integrated database retrieval system