KEGG   Acinonyx jubatus (cheetah): 106970422Help
Entry
106970422         CDS       T04657                                 

Definition
(RefSeq) cationic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04080  Neuroactive ligand-receptor interaction
aju04972  Pancreatic secretion
aju04974  Protein digestion and absorption
aju05164  Influenza A
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106970422
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    106970422
   04974 Protein digestion and absorption
    106970422
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    106970422
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aju01002]
    106970422
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106970422
Enzymes [BR:aju01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     106970422
Peptidases [BR:aju01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106970422
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106970422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Toxin_4
Motif
Other DBs
NCBI-GeneID: 106970422
NCBI-ProteinID: XP_014922525
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MKTFIFLALLGAAVAFPIDDDDKIVGGYTCPRNSVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSRIQVRLGEHNIAVSEGSEQFINSAKVIRHPRYNANTIDNDIMLIKLSSPATLN
SRVSAISLPRSCAPSGSQCLISGWGNVQSFGENYPDVLQCLKAPILTDSACRKAYPGQIT
SNMICLGFLEGGKDSCQGDSGGPVVCNNQLQGIVSWGAGCAQRGKPGVYTKVCNYVSWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatcttccttgctctcctgggagctgctgtggctttccccattgatgac
gatgacaagatcgttgggggctacacctgtccgaggaactctgtcccctaccaggtgtcc
ctgaactcgggctaccacttctgtggcggctccctcatcaattcccagtgggtggtgtct
gcggctcactgctacaagtcccgaatccaggtgcgtctgggagaacacaacattgcagtc
tctgagggcagtgaacaattcatcaattcggccaaggtcatccgccacccgagatacaat
gcaaacactattgataatgacatcatgctgattaaattgagctcacctgccaccctcaac
tctcgagtgtctgctatctctctgccaagatcttgtgcaccttctggttcccagtgcctc
atctctggctggggaaatgtccagagctttggggaaaattatcccgatgtcctgcagtgt
ctgaaagctcccatactaactgacagtgcttgccgtaaagcctacccaggccagatcacc
agcaacatgatctgtctgggcttcctggaaggcggaaaggactcttgccagggtgactct
ggtggccctgtggtctgcaacaaccagctccagggcattgtctcctggggtgccggctgc
gctcaaagaggtaaacccggtgtctacaccaaggtctgcaactatgtgagctggattcag
cagaccatcgctgccaactaa

DBGET integrated database retrieval system