KEGG   Acinonyx jubatus (cheetah): 106970446Help
Entry
106970446         CDS       T04657                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00052  Galactose metabolism
aju00500  Starch and sucrose metabolism
aju01100  Metabolic pathways
aju04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106970446 (MGAM)
   00500 Starch and sucrose metabolism
    106970446 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    106970446 (MGAM)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     106970446 (MGAM)
    3.2.1.20  alpha-glucosidase
     106970446 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 106970446
NCBI-ProteinID: XP_014922562
LinkDB All DBs
Position
Unknown
AA seq 1825 aa AA seqDB search
MARRKLKYFTSLELMLSVLLLVVFIITIPLFVLSAMDSSESKDPGTTSTTPGSAECPVVN
EVERINCIPDQPPTKATCDQRGCCWRPQGAISVPWCYYSKSHGYQMEGDLVKTNAGFTAQ
LDRLPSPSLFGNDVNSVLLTAEYQTANRFHFKLTDQSKGRYEVPHEHVQPFKGNAASPLT
YEVVVSKQPFSIKVIRRSNNRVLLDSSIGPLLFADQFLQFSARLPSPNVYGLGEQVHRQY
RHDMNWKTWSMFARDTIPSGDGTNLYGTQTFFLCLEDASGLSFGLFLMNSNAMEVTLQPA
PAVTYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYDYGTLQNMR
EVVERNRAAQLPYDVQHADIDYMDERKDFTYDPVNFKGFPEFVKELHNNGQKLVIIVDPA
ISNNSSPSNPYGPYDRGSDAKIWVNVSDGVTPLIGEVWPGKTVFPDYTNPNCAVWWAKEF
ELFYNQVEFDGIWIDMNEVSNFVDGSVSGCSTSNLNYPPFTPRILDGYLFCRSLCMDAVQ
HWGKQYDVHNLYGYSMAIATTQAVKTVFPNKRSFIITRSTFAGSGKFAAHWLGDNAATWN
DLRWSIPGMLEFNLFGIPMVGADICGFALDAPEELCRRWMQLGAFYPFSRNHNGQGYKAQ
DPASFGATSLLLNSSRHYLTIRYTLLPYLYTLFYWAHSRGNTVARPLLHEFYRDSNTWDV
HQQFLWGPGLLITPVLEEGAEKVMAYMPDAIWYDYETGARTRWRKQRVEMELPGDKIGLH
LRGGHVFPTQQPATTTVVSRRNPLGLIIALDENKEAKGELFWDDGETKDTVGSKIYLLCE
FSVTQNRLDVKILQSTYKDPNNLVFKEIKILGIQEPNNVIVKHNGVPSQISPNVTYDSNL
QVALITEIDLVLGEAYTVEWGLKIRDAEKIDCYPDESGASAENCTARGCAWEAPSSPGVP
FCYFVNDLYSVGDIQYDSRGATATVSLKSSLYASALPSVPVTSLRVQVTYHKNDMVQFKI
YDPNNNRYEVPVPLNIPRVPSGTTEGQLYDVLIKKNPFGIEIRRKSTGSVIWDSQLLGFT
FNDMFIRISTRLPSQYVYGFGETEHTAFRRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYM
ALEQDGSAHGVLLLNSNAMDVTFQPLPALTYRTIGGILDFYVFLGPTPELVTQQYTELIG
RPVMVPYWALGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPK
FAGFPALITRMKADGMRVILILDPAISGNETQPYPAFTRGVEDDVFIKAPNGGGIVWGKV
WPDFPNVVVNGSLDWESQVEQYRAYVAFPDFFRNSTATWWKREMRELYTNPRDPEKSLKF
DGMWIDMNEPASFVNGAVPPGCRDATLNHPPYMPHLESRDMGLSSKTLCMESQQILPDGS
LVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNTAAWDQL
KKSIIGMLEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFSRNHNTIGTRRQDP
VSWDATFVNISRSVLKTRYTLLPYLYTLMHMAHTEGSTVVRPLLHEFVSDRLTWDVDRQF
LLGPAFLVSPVLEANARNVTAYFPRARWYDYYTGVDIKARGEWKTLLAPLDHINLHVRGG
FILPWQEPAQNTHLSRQKFIGFKVALDDEGTAKGWLFWDDGQSIDTYGKGLYYLANFSAS
QNTMQSHIIFNKCITDTNPLKLGYVEIWGVGSVSISSVSISASGMVIRPTFTYNPASQVL
SIDMTSTDISLHKFISLTWRSTLNL
NT seq 5478 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaggaagttgaaatatttcacgagtttggagcttatgctcagtgttcttctg
cttgtggtgtttatcatcactattcccctgttcgtgctttcagccatggattcttcagaa
tctaaagatcctgggacaacgagtaccactccgggttctgctgagtgtccagtggtcaat
gaagtggaacggataaactgcatccctgaccagccaccaacaaaggccacatgtgatcag
cgtgggtgctgctggagaccgcagggggctataagtgtgccctggtgctactattctaaa
agccatggttatcaaatggagggtgaccttgtaaaaacaaatgcaggattcacagcccag
ttggacaggttgccttctccatccctgtttggaaatgatgtcaacagtgtccttctcaca
gcagaataccagacagccaaccgtttccactttaagttgaccgaccagagcaagggcagg
tatgaagtgccccatgaacatgtgcaaccattcaaaggaaatgctgcttctcctttgacc
tatgaggttgttgtctccaaacagccatttagcatcaaagtgatcagaagaagcaataat
cgtgtcctgttggactcaagcatcggacccctcctgtttgccgatcagttcctgcagttc
tctgcccggctgcccagtcctaacgtgtatggtctgggagaacaggtgcaccgacagtac
cggcatgacatgaactggaagacctggtccatgtttgccagggacacaatccccagtggg
gatggaactaacttgtatggtacacagacattcttcctgtgtcttgaagatgccagcgga
ctgtcctttggactgtttctgatgaatagcaatgccatggaggttaccctccagcctgcc
ccagctgtcacttaccgcactatcggaggcatcctcgacttctatgtgtttttgggaaat
actccagagcaagttgttcaagaatatctagagctcattggacggccagcccttccctca
tactgggcacttggatttcatctcagtcggtatgattatggaaccctacagaacatgaga
gaagtcgtggagagaaaccgtgccgcacagctcccttatgatgttcagcatgctgatatt
gattatatggatgagaggaaggacttcacttatgacccagtaaattttaaaggcttccct
gagtttgttaaggagttacacaataacggacagaaattggtcatcattgtggatccagcc
atctccaacaactcttccccaagcaacccctatggcccatatgacaggggttcagatgcg
aagatatgggtgaatgtttcagatggggtgactccgctcattggggaggtctggcctgga
aaaactgtgtttcctgattataccaaccccaactgtgctgtttggtgggcaaaggaattt
gagcttttctacaatcaagtggagtttgacggaatctggattgatatgaatgaagtttcc
aacttcgttgatggttctgtttcaggatgttccacgagcaacctaaattaccccccattc
actcccagaatcctggatgggtacctgttctgcaggagcctctgcatggatgcagtgcag
cactggggcaagcagtacgatgtccacaatctgtacggctactccatggcgattgccacc
acacaagctgtcaagactgtgttccctaataagagaagcttcattataacccgttcgacc
tttgcgggatctggcaagtttgcagcccattggttaggagacaacgcagccacctggaat
gatctccggtggtctatccctggcatgctcgagttcaacctttttggtatcccaatggtc
ggtgctgacatatgtggctttgcattggatgcccctgaggagctctgcaggcggtggatg
cagctgggagcgttttatccattttccaggaatcacaatggccaaggctacaaggcccag
gatcctgcctcctttggagctacctccctgctgctgaattcctccaggcactaccttacc
atccgctacaccctgttaccctacctctataccctcttctattgggcccacagccggggg
aacacggtggccaggccccttctgcatgagttctacagggacagcaacacgtgggatgta
caccaacagtttttatggggacctggcctccttatcactccagttctggaagagggtgca
gagaaagtgatggcttatatgcccgatgccatctggtatgattacgagactggggcccga
acgagatggaggaagcaaagagtggagatggaacttcctggagacaaaatcggactccac
cttcgcggaggccatgtattccccacacaacagcccgccaccaccactgtggtcagtcga
cggaaccctcttggtctcatcatcgccctagatgagaacaaagaagccaaaggcgaactt
ttctgggacgatggggaaactaaagatactgtgggcagtaaaatctatctcttatgtgag
ttttctgtcacccaaaaccgcttggatgtgaagattttgcagtcaacctacaaagacccc
aataatttagtatttaaagagattaaaattcttgggatccaggagcctaacaatgttata
gtgaaacacaatggtgtcccaagtcagatttctcctaatgtcacttatgattctaaccta
caggtcgcccttatcacggaaattgatcttgtcctgggagaagcatacacagtggagtgg
ggcctgaagataagggatgcagaaaaaatagactgttatcccgatgagagtggtgcttct
gcagaaaactgtactgcccgtggctgtgcctgggaggcacctagttctcctggggtccca
ttttgttattttgtcaatgacctgtactctgtcggcgacattcagtacgactcacgtggc
gccactgctactgtctcattaaagtcttctttatatgcctctgctctgccctcggtaccc
gtgacctccctccgtgtgcaagtgacctaccataagaacgacatggtgcagtttaagatt
tatgatcctaacaacaatcggtatgaagtcccggtgcctctcaacatacccagggttcca
tccggcaccacagagggtcagctgtatgatgtcctcatcaagaagaatccgtttgggatt
gaaattcgccggaagagtacgggctctgtaatttgggactctcagctccttggctttacc
ttcaatgacatgttcatccgcatctccactcgccttccctcccaatacgtctatggcttt
ggggaaactgagcacacagcctttcggagagacttgaactggcacacgtgggggatgttc
tcccgagaccaacccccggggtacaagaagaattcctatggcgtccacccctactacatg
gcactggagcaggatggcagtgcccatggagtgctcctgctaaacagcaacgccatggat
gtgacattccagcccctgcctgccttgacgtaccgcaccatagggggaattctggacttt
tatgtgttcttggggccaactcccgagcttgtcactcagcagtatactgagttgatcggt
cggccagtgatggttccttactgggccttgggatttcagctgtgtcgctatggataccag
aatgactctgagattgccagcttgtatgatgagatggtggctgcccagattccttatgac
gttcagtactcagacatcgactacatggagcggcagctggacttcaccctcagccccaag
tttgcaggatttccagctctgatcactcgcatgaaggccgacgggatgcgggtcatcctt
attctggacccagccatttctgggaacgagacacagccctatcctgcattcacccggggt
gtggaggatgatgtcttcatcaaagctccaaatggtggtggcattgtctggggaaaggtg
tggcctgatttccctaatgtcgttgtaaacgggtctctagactgggagagtcaagtggag
caataccgagcttacgtggccttcccagactttttccgtaattcaactgccacatggtgg
aagagggagatgcgagaactatataccaatccacgggatccagagaagagcttgaagttt
gatggcatgtggattgatatgaacgagccggcgagttttgtgaatggagcagtgccccca
ggctgcagggatgccactctgaaccaccctccctatatgccacatttggagtccagggac
atgggccttagcagcaagaccctgtgcatggagagtcagcagatcctgccagacggctca
ctggtgcgacactatgacgtgcacagcctgtacggatgggctcagaccagacccacttac
gaagctgtgcaggaggtgacgggacagagagggattgtcatcacccgctccacattcccc
tcttctggccgctggggaggtcactggctgggagacaacacagctgcctgggaccagctg
aagaagtctatcattggcatgttggagttcagcctctttggcatatcttatacaggagca
gatatttgtggattctttcaagatgctgaatatgagatgtgtgctcgctggatgcaactg
ggggccttttaccccttctcgaggaaccacaacaccattgggaccaggaggcaagaccct
gtgtcctgggatgcaacatttgtgaatatctccagaagtgtcctgaagaccagatatacc
ctgttgccatatctctacaccctgatgcacatggcccacacggagggcagcactgtcgtc
cggcctcttctccatgagttcgtgtcagaccggttgacctgggatgtggaccgtcagttt
ctgctgggcccagccttcctggtcagccctgtcctggaggctaatgcccgaaacgtcact
gcatatttccccagagcccgctggtatgattactacacgggtgtggacatcaaagcaagg
ggagaatggaagaccttgctggcccctcttgaccacattaatctacacgtccgtgggggc
ttcatcctgccctggcaagagcctgcacagaacacccacttaagccgtcagaaattcatt
ggcttcaaggttgccttggatgatgaggggactgctaaaggttggctcttctgggatgat
gggcaaagcattgatacctatggaaaaggactctattacctggccaacttttccgccagc
caaaatacgatgcagagtcatataattttcaacaaatgtatcaccgatacaaaccctttg
aaactgggctacgtggagatctggggagtgggcagcgtctccatttccagtgtcagcatc
tctgcgagcggcatggtgatcagacccaccttcacttataaccctgcttcacaggtgtta
agcattgatatgaccagcacagacatcagcctccataagttcatttcactgacgtggaga
agcactctgaatttgtag

DBGET integrated database retrieval system