KEGG   Acinonyx jubatus (cheetah): 106970741Help
Entry
106970741         CDS       T04657                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00010  Glycolysis / Gluconeogenesis
aju00053  Ascorbate and aldarate metabolism
aju00071  Fatty acid degradation
aju00260  Glycine, serine and threonine metabolism
aju00280  Valine, leucine and isoleucine degradation
aju00310  Lysine degradation
aju00330  Arginine and proline metabolism
aju00340  Histidine metabolism
aju00380  Tryptophan metabolism
aju00410  beta-Alanine metabolism
aju00561  Glycerolipid metabolism
aju00620  Pyruvate metabolism
aju01100  Metabolic pathways
Module
aju_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
aju_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106970741 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    106970741 (ALDH7A1)
   00620 Pyruvate metabolism
    106970741 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106970741 (ALDH7A1)
   00561 Glycerolipid metabolism
    106970741 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106970741 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    106970741 (ALDH7A1)
   00310 Lysine degradation
    106970741 (ALDH7A1)
   00330 Arginine and proline metabolism
    106970741 (ALDH7A1)
   00340 Histidine metabolism
    106970741 (ALDH7A1)
   00380 Tryptophan metabolism
    106970741 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106970741 (ALDH7A1)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106970741 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     106970741 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     106970741 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 106970741
NCBI-ProteinID: XP_014922921
LinkDB All DBs
Position
Un
AA seq 539 aa AA seqDB search
MWRVPRQLCAHHLRGSKLSDAWNRPAAFMSTLLINQAQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWRIWAEVPAPKRGEVVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQIRVG
NPWDSNVLYGPLHTKQSVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHD
ASIAHTETFAPILYVFKFKSEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtgccccgccagctgtgtgcgcaccacttgaggggaagcaaactctcggac
gcttggaacaggcctgccgccttcatgtccactttgctcatcaatcaggcccagtacgct
tggctgaaggagttggggctccgcgaggaaaacgagggcgtgtataatggaagttgggga
ggccggggagaggttatcacgacttattgtcctgctaacaatgaaccaatagcaagagtc
cgacaggccagcgtggccgactatgaagaaaccgtgaagaaagcaagggaagcctggaga
atctgggcagaggttcctgctccgaagagaggagaagtagtgagacagattggggatgcc
ttgcgggagaagatccaagtactaggaagtttggtgtctttggagatggggaaaatctta
gtggaaggtgtaggagaagttcaagagtacgtggatatttgtgattatgctgttggctta
tcacggatgattgggggacccatcttgccttctgaaagacctggccatgccctcattgaa
cagtggaatcctgtaggcctggttggcatcatcactgcgttcaacttccctgtggcagtg
tatggctggaacaatgccattgccatgatctgtgggaatgtctgcctttggaaaggagct
ccaacaacttccctcattagtgtagctgtcacaaagataatagccaaggttctagaagac
aacaaactgcctggtgctatttgttccttgacctgtggtggagcagatataggcactgca
atggccaaagatgaacgggtgaacctgctgtccttcaccgggagcacacaggtgggaaaa
caggtggcccttatggtgcaggagagatttgggagaagtttgttagaacttggaggaaac
aatgccatcattgcttttgaggatgcagacctcagcttggtcgttccgtcggctctcttc
gcagccgtggggacagcgggccagagatgtaccactgcgcggcgcctgtttttacatgag
agcatccatgatgaagttgtaaatagacttaaaaaggcctatgcacagatccgtgtgggg
aacccttgggactctaatgtcctctacgggccactccacaccaaacagtcagtgagcatg
tttcttggagcagtggaggaagcaaagaaagaaggtggcactgtggtctatggtggcaag
gttatggatcgccctggaaattatgtagaacccaccattgtgacaggtctggcccacgat
gcgtccattgcccacacagaaacgtttgctccaatcctttatgtctttaaattcaagagt
gaagaagaagtctttgcatggaataatgaagtaaaacagggactttcaagtagcatcttt
accaaggatttgggcagaatcttccgctggcttggaccgaaaggatcagactgtggcatt
gtaaacgtcaatatcccaacgagtggggccgaaattggaggtgcatttggaggagaaaag
cacactgggggcggccgcgagtctggtagcgatgcctggaaacagtacatgagaagatcc
acttgcaccatcaactacagtaaggaccttcctctagctcaaggaatcaagtttcagtaa

DBGET integrated database retrieval system